Патенти з міткою «імуноглобуліну»

Fc-фрагмент імуноглобуліну igg4, який має модифіковану шарнірну ділянку

Завантаження...

Номер патенту: 115906

Опубліковано: 10.01.2018

Автори: Парк Сон Хі, Чун Сун Юб, Лі Чон-Су, Чхой Ін Йон, Хух Йон Хо

МПК: C12N 15/13, C07K 7/08, A61K 47/42 ...

Мітки: igg4, ділянку, імуноглобуліну, шарнірну, fc-фрагмент, має, модифіковану

Формула / Реферат:

1. Модифікований фрагмент Fc-ділянки імуноглобуліну IgG4, що містить модифіковану шарнірну ділянку, в якому частину цієї шарнірної ділянки, представленої наступною амінокислотною послідовністю, видалено делецією з утворенням лише одного цистеїнового залишку: Glu-Ser-Lys-Tyr-Gly-Pro-Pro-Cys-Pro-Ser-Cys-Pro.2. Модифікований фрагмент Fc-ділянки імуноглобуліну IgG4 за п. 1, в якому не відбувається реакція обміну ланцюгів та...

Спосіб прогнозування рівня секреторного імуноглобуліну а в слині дітей, хворих на бронхіальну астму

Завантаження...

Номер патенту: 115848

Опубліковано: 26.12.2017

Автори: Кривенко Людмила Станіславівна, Назарян Розана Степанівна

МПК: G01N 33/48, A61B 10/00, A61M 25/00 ...

Мітки: спосіб, бронхіальну, секреторного, прогнозування, хворих, рівня, імуноглобуліну, слині, астму, дітей

Формула / Реферат:

Спосіб прогнозування рівня секреторного імуноглобуліну А в слині дітей, хворих на бронхіальну астму, який включає визначення у дитини, хворої на бронхіальну астму, індексу оцінки стану тканин ясен і кровоточивості шляхом зондування ясенних сосочків за допомогою ґудзикуватого зонда з наступною оцінкою результатів зондування за шкалою H.R. Muhlemann та S. Son і при величині індексу H.R. Muhlemann та S. Son на рівні 3,72±0,27 балів рівень...

Спосіб отримання галузевого стандартного зразка антирабічного імуноглобуліну

Завантаження...

Номер патенту: 118385

Опубліковано: 10.08.2017

Автори: Мазур Микола Вікторович, Нікітова Аліна Петрівна, Недосєков Віталій Володимирович, Мазур Наталія Вікторівна, Ничик Сергій Анатолійович, Полупан Іван Миколайович

МПК: C07K 16/00

Мітки: зразка, стандартного, галузевого, антирабічного, імуноглобуліну, отримання, спосіб

Формула / Реферат:

Спосіб отримання Галузевого стандартного зразка антирабічного імуноглобуліну включає ліофільне висушування розведеного в 10 разів фосфатно-сольовим буферним розчином (ФБС) концентрованого антирабічного імуноглобуліну із сироватки крові гіперімунізованих кролів та калібрування його до Другого міжнародного стандарту антирабічного імуноглобуліну людини (The 2nd International Standard for anti-rabies immunoglobulin, human), який відрізняється...

Кон’югат, що містить похідну оксинтомодуліну, fc-ділянку імуноглобуліну та непептидильний полімер, та його застосування

Завантаження...

Номер патенту: 114709

Опубліковано: 25.07.2017

Автори: Чхой Ін Йон, Квон Се Чхан, Кім Те Чін, Ву Йон Юн, Чун Сун Юб, Парк Сун Хее

МПК: A61K 47/50, C07K 14/605, A61K 38/26 ...

Мітки: непептидильний, fc-ділянку, похідну, кон'югат, імуноглобуліну, оксинтомодуліну, містить, полімер, застосування

Формула / Реферат:

1. Кон'югат, що містить похідну оксинтомодуліну, Fc-ділянку імуноглобуліну та непептидильний полімер, де непептидильний полімер є ковалентно зв'язаним з похідною оксинтомодуліну та Fc-ділянкою імуноглобуліну, де похідна оксинтомодуліну включає амінокислотну послідовність, вибрану з групи, що складається з SEQ ID NO: 24, 25 та 26.2. Кон'югат за п. 1, в якому похідна оксинтомодуліну включає амінокислотну послідовність SEQ ID NO:...

Спосіб прогнозування рівня секреторного імуноглобуліну а в слині дітей, хворих на борнхіальну астму

Завантаження...

Номер патенту: 117456

Опубліковано: 26.06.2017

Автори: Кривенко Людмила Станіславівна, Назарян Розана Степанівна

МПК: G01N 33/00, A61M 25/00

Мітки: секреторного, прогнозування, хворих, борнхіальну, слині, рівня, спосіб, дітей, імуноглобуліну, астму

Формула / Реферат:

Спосіб прогнозування рівня секреторного імуноглобуліну А в слині дітей, хворих на бронхіальну астму, який включає визначення у дитини, хворої на бронхіальну астму, індексу оцінки стану тканин ясен і кровоточивості шляхом зондування ясенних сосочків за допомогою ґудзикуватого зонду з наступною оцінкою результатів зондування за шкалою H.R. Muhlemann та S. Son, і при величині індексу H.R. Muhlemann та S. Son на рівні 3,72±0,27 бала рівень...

Спосіб отримання вірусобезпечного імуноглобуліну для внутрішньовенного введення

Завантаження...

Номер патенту: 99135

Опубліковано: 25.05.2015

Автори: Загородня Юлія Олександрівна, Тимченко Анатолій Сергійович, Сергутіна Світлана Юріївна

МПК: A61K 39/395, C07K 16/06

Мітки: вірусобезпечного, внутрішньовенного, отримання, спосіб, імуноглобуліну, введення

Формула / Реферат:

Спосіб отримання вірусобезпечного імуноглобуліну для внутрішньовенного введення шляхом суспендування осаду ІІ+ІІІ, одержаного за методом Кона, осадження високомолекулярних агрегатів поліетиленгліколем, відокремлення осаду баластних білків, який відрізняється тим, що вводять суміш сольвенту (0,3 % маси три-н-бутилфосфату) і детергенту (1 % маси полісорбату 80) та витримують 8-10 год., очищають методом аніоно- та катіонообмінної хроматографії,...

Спосіб діагностики глютенової ентеропатії у осіб з селективним дефіцитом імуноглобуліну а

Завантаження...

Номер патенту: 98300

Опубліковано: 27.04.2015

Автори: Мальцев Дмитро Валерійович, Казмірчук Віра Євстафіївна, Царик Владислав Вікторович

МПК: G01N 33/53

Мітки: ентеропатії, глютенової, селективним, спосіб, осіб, діагностики, імуноглобуліну, дефіцитом

Формула / Реферат:

Спосіб діагностики глютенової ентеропатії у осіб з селективним дефіцитом імуноглобуліну А шляхом дослідження плазми крові, який відрізняється тим, що додатково визначають загальний рівень сироваткового імуноглобуліну А і G та, при виявленні високого рівня імуноглобуліну G до гліадину та низьких титрів імуноглобуліну А, діагностують глютенову ентеропатію.

Спосіб оцінки параметрів молекул імуноглобуліну класу igg у зразках сироватки крові

Завантаження...

Номер патенту: 95297

Опубліковано: 25.12.2014

Автори: Думич Тетяна Ігорівна, Томін Андрій Миколайович, Білий Ростислав Олександрович, Стойка Ростислав Степанович, Магорівська Ірина Богданівна

МПК: G01N 33/53

Мітки: сироватки, оцінки, молекул, імуноглобуліну, параметрів, крові, спосіб, класу, зразках

Формула / Реферат:

Спосіб оцінки параметрів молекул імуноглобуліну класу IgG у зразках сироватки крові, що виконується шляхом імуноферментного аналізу, зокрема оцінки вмісту глікозильних детермінант, каталітичної активності, здатності утворювати супрамолекулярні комплекси, тощо, який відрізняється тим, що для прямої оцінки параметрів молекул імуноглобуліну IgG в зразках сироватки крові як імуносорбент використовують фрагменти антитіл (наприклад F(ab)2 чи Fab)...

Одиничний варіабельний домен імуноглобуліну проти рецептора типу 1 tnfa

Завантаження...

Номер патенту: 107200

Опубліковано: 10.12.2014

Автори: де Сілва Інуша, Сепп Армін, Ступ Едріан Алларт

МПК: A61K 39/395, C07K 16/28, A61P 29/00 ...

Мітки: одиничній, імуноглобуліну, варіабельний, домен, рецептора, типу

Формула / Реферат:

1. Одиничний варіабельний домен імуноглобуліну проти рецептора типу 1 TNFα (TNFR1; р55), що включає амінокислотну послідовність, яка є ідентичною амінокислотній послідовності DOM1h-574-208 (SEQ ID NO: 59).2. Мультиспецифічний ліганд, що включає одиничний варіабельний домен імуноглобуліну за п. 1.3. Мультиспецифічний ліганд за п. 2, що додатково включає принаймні один одиничний варіабельний домен імуноглобуліну, який...

Спосіб верифікації ізольованого дефіциту імуноглобуліну е

Завантаження...

Номер патенту: 94777

Опубліковано: 25.11.2014

Автори: Мальцев Дмитро Валерійович, Казмірчук Віра Євстафіївна, Царик Владислав Вікторович

МПК: A61B 10/00

Мітки: дефіциту, верифікації, імуноглобуліну, спосіб, ізольованого

Формула / Реферат:

Спосіб верифікації ізольованого дефіциту імуноглобуліну Е, що включає використання імуноферментного аналізу (ELISA) в одиницях вимірювання МЕ/мл, який відрізняється тим, що при первинному виявленні рівня сироваткового імуноглобуліну Е менше 5 МО/мл, проводять його повторне визначення після лікування хворого та санації вогнищ інфекції не раніше ніж через 28 діб, при повторному підтвердженні вказаної концентрації верифікують ізольований...

Одиничний варіабельний домен імуноглобуліну проти рецептора tnfa типу 1

Завантаження...

Номер патенту: 103749

Опубліковано: 25.11.2013

Автори: Томлінсон Ян М., Жеспер Лоран, Еневер Каролін, Пупецка Мальґоржата

МПК: A61K 39/395, C07K 16/28, A61P 11/00 ...

Мітки: імуноглобуліну, варіабельний, рецептора, типу, домен, одиничній

Формула / Реферат:

1. Одиничний варіабельний домен імуноглобуліну проти рецептора TNFα типу 1, який включає амінокислотну послідовність, що є ідентичною амінокислотній послідовності DOM1h-131-206 та яка має наведену нижче амінокислотну послідовність:EVQLLESGGGLVQPGGSLRLSCAASGFTFAHETMVWVRQAPGKGLEWVSHIPPDGQDPEYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYHCALLPKRGPWFDYWGQGTLVTVSS.2. Одиничний варіабельний домен імуноглобуліну проти...

Анти-vegf одиничний варіабельний домен імуноглобуліну

Завантаження...

Номер патенту: 102993

Опубліковано: 10.09.2013

Автори: Пупецка Мальґоржата, Жеспер Лоран, Ст'юард Майкл, Інівер Каролін, Томлінсон Ян, Батуванґала Тіл Дінук

МПК: A61P 11/00, A61P 35/00, A61K 39/395 ...

Мітки: імуноглобуліну, анти-vegf, одиничній, варіабельний, домен

Формула / Реферат:

1. Анти-VЕGF одиничний варіабельний домен імуноглобуліну, який включає амінокислотну послідовність, яка є ідентичною амінокислотній послідовності DОМ15-26-593, як представлено на Фігурі 5, або відрізняється від амінокислотної послідовності DОМ15-26-593 в 1 або 2 амінокислотних положеннях. 2. Анти-VЕGF одиничний варіабельний домен імуноглобуліну за п. 1, який включає амінокислотну послідовність, яка є ідентичною амінокислотній...

Спосіб отримання fc-фрагмента імуноглобуліну, вільного від початкового метіонінового залишку, в масовому масштабі

Завантаження...

Номер патенту: 97628

Опубліковано: 12.03.2012

Автори: Дзунг Сунг юб, Шин Дзин хван, Сонг Дае хае, Лі Гван-Сун, Кім Дзин сун, Квон Се-Чанг

МПК: C12P 21/08, C07K 16/00

Мітки: метіонінового, імуноглобуліну, залишку, початкового, спосіб, масовому, вільного, масштабі, fc-фрагмента, отримання

Формула / Реферат:

1. Спосіб отримання Fc-фрагмента імуноглобуліну, вільного від початкового метіонінового залишку, в масовому масштабі, який включає:отримання рекомбінантного експресуючого вектора, який включає нуклеотидну послідовність, що кодує рекомбінантний Fc-фрагмент імуноглобуліну, складений з Fc-фрагмента імуноглобуліну, зв'язаного своїм N-кінцем з шарнірною областю імуноглобуліну за допомогою пептидного зв'язку;трансформування...

Гуманізована специфічна до cd37 зв’язувальна молекула імуноглобуліну

Завантаження...

Номер патенту: 97469

Опубліковано: 27.02.2012

Автори: Хайден-Ледбеттер Марта Сюзан, Томпсон Пітер Армстронг, Бред Уільям, Гросмейр Лаура Сью, Ледбеттер Джеффрі А., Саймон Санді Алєксандер

МПК: A61K 39/395, A61P 37/00, A61P 35/00 ...

Мітки: зв'язувальна, імуноглобуліну, специфічна, молекула, гуманізована

Формула / Реферат:

1. Гуманізована специфічна до CD37 зв’язувальна молекула імуноглобуліну, що містить варіабельну ділянку легкого ланцюга й варіабельну ділянку важкого ланцюга, де(і) гуманізована специфічна до CD37 зв’язувальна молекула зв'язує CD37 людини, і(ii) (a) варіабельна ділянка легкого ланцюга включає CDR1 легкого ланцюга, наведену в SEQ ID NO:61 або 62, CDR2 легкого ланцюга, наведену в SEQ ID NO:64, і CDR3 легкого ланцюга, наведену в...

Химерні гібриди мономер-димер імуноглобуліну

Завантаження...

Номер патенту: 95436

Опубліковано: 10.08.2011

Автори: Петерс Роберт Т., Лоу Сьюзан С., Мезо Адам Р., Рівера Деніел С., Статтел Джеймс М., Бітонті Алан Дж.

МПК: A61P 7/00, A61K 38/17, A61P 31/12 ...

Мітки: химерні, гібриди, імуноглобуліну, мономер-димер

Формула / Реферат:

1. Химерний білок, що містить перший і другий поліпептидні ланцюги, де вказаний перший ланцюг містить біологічно активну молекулу і щонайменше тільки частину константної ділянки імуноглобуліну, де тільки перший ланцюг містить біологічно активну молекулу і де вказаний другий ланцюг містить щонайменше частину виключно константної ділянки імуноглобуліну.2. Химерний білок за п. 1, де вказаний другий ланцюг, додатково, містить афінну...

Спосіб застосування специфічного імуноглобуліну для лікування сепсису і тяжких інфекцій, що викликані грамнегативними бактеріями

Завантаження...

Номер патенту: 56131

Опубліковано: 10.01.2011

Автори: Замковой Анатолій Дем'янович, Пархоменко Лариса Василівна, Доан Світлана Іванівна, Тимохіна Людмила Владимирівна, Ханес Генадій Сандерович

МПК: A61K 39/112

Мітки: спосіб, специфічного, викликані, імуноглобуліну, лікування, грамнегативними, застосування, тяжких, бактеріями, сепсису, інфекцій

Формула / Реферат:

Спосіб застосування специфічного імуноглобуліну проти грамнегативних бактерій для лікування сепсису і тяжких інфекцій, що викликані цими збудниками, що включає проведення базової терапії, який відрізняється тим, що пацієнту парентерально вводять специфічний імуноглобулін в дозі від 0,02 до 0,3 мл на 1 кг ваги курсом до 3-6 доз.

Спосіб отримання протикорового імуноглобуліну

Завантаження...

Номер патенту: 48598

Опубліковано: 25.03.2010

Автори: Степанчук Валентин Андрійович, Марічев Ігор Леонідович, Рубан Віктор Іванович

МПК: A61K 35/16

Мітки: спосіб, отримання, імуноглобуліну, протикорового

Формула / Реферат:

Спосіб отримання протикорового імуноглобуліну шляхом етанолового фракціонування на холоді донорської плазми крові методом фільтрації, освітлення та стерилізації, який відрізняється тим, що здійснюють повторну концентрацію та стерилізацію для подальшого збільшення природних протикорових антитіл у титрах 1:960-1:1440.

Спосіб отримання специфічного імуноглобуліну людини проти вірусу гепатиту с (hcv)

Завантаження...

Номер патенту: 45557

Опубліковано: 10.11.2009

Автори: Бабак Костянтин Анатолійович, КОРНІЄНКО ВАСИЛЬ ІВАНОВИЧ, Тимченко Анатолій Сергійович

МПК: A61K 39/395

Мітки: hcv, імуноглобуліну, вірусу, людини, специфічного, гепатиту, отримання, спосіб

Формула / Реферат:

Спосіб отримання специфічного імуноглобуліну проти вірусу гепатиту С (HCV) шляхом етанолового фракціонування донорської плазми крові або осаду фракції ІІ+ІП від донорів, які хворіли на гепатит С, за модифікованим спиртовим методом Кона з достатніми титрами специфічних антитіл до вірусу гепатиту С, із подальшою концентрацією, фільтрацією і освітленням, який відрізняється тим, що кінцевий розчин імуноглобуліну, що містить 8,0-12,0 % білка і...

Спосіб одержання імуноглобуліну

Завантаження...

Номер патенту: 85741

Опубліковано: 25.02.2009

Автори: Самойленко Вадим Анатолійович, Скринник Максим Михайлович, Діденко Наталія Юріївна, Курищук Костянтин Васильович, Куркіна Оксана Вікторівна

МПК: C07K 16/06, C07K 1/36, C07K 1/18 ...

Мітки: спосіб, імуноглобуліну, одержання

Формула / Реферат:

1. Спосіб одержання імуноглобуліну, що включає фракціонування етиловим спиртом донорської плазми з отриманням осаду Б та очищення виділеного імуноглобуліну, який відрізняється тим, що осад Б розчиняють у 0,9 %-ному розчині натрію хлориду при pH 5,15 і змішують з 2 М ацетатним буферним розчином та з 53 %-ним етиловим спиртом з наступним центрифугуванням при температурі мінус (3...5) ºС, отриманий центрифугат змішують з гідрокарбонатом...

Спосіб інактивації вірусів при одержанні імуноглобуліну

Завантаження...

Номер патенту: 85734

Опубліковано: 25.02.2009

Автори: Куркіна Оксана Вікторівна, Курищук Костянтин Васильович, Скринник Максим Михайлович, Самойленко Вадим Анатолійович, Діденко Наталія Юріївна

МПК: C07K 1/18, C07K 1/36, C07K 16/06 ...

Мітки: одержанні, інактивації, вірусів, спосіб, імуноглобуліну

Формула / Реферат:

 1. Спосіб інактивації вірусів при одержанні імуноглобуліну, що включає очистку розчину імуноглобуліну, виділеного спиртовим фракціонуванням, який відрізняється тим, що при очистці розчин імуноглобуліну попередньо обробляють сольвент-детергентною сумішшю 0,05 М ацетатного буферного розчину при pH 5,5, що містить 1 % мас. три-н-бутилфосфату і 1 % мас. полісорбату 80, і обробку ведуть шляхом перемішування суміші протягом 12...16 годин...

Спосіб отримання імуноглобуліну проти вірусу кліщового енцефаліту

Завантаження...

Номер патенту: 23608

Опубліковано: 11.06.2007

Автори: Шоломей Михайло Володимирович, Федорук Володимир Ілліч, Козловський Михайло Михайлович, Білецька Галина Вацлавівна, Семенишин Оксана Богданівна, Рогочий Євген Георгійович, Друль Оксана Стефанівна, Пластунов Валерій Анатолієвич, Малишев Олександр Юрійович, Лозинський Ігор Миколайович

МПК: A61K 39/395, A61K 39/42

Мітки: вірусу, кліщового, імуноглобуліну, енцефаліту, спосіб, отримання

Формула / Реферат:

Спосіб отримання імуноглобуліну проти вірусу кліщового енцефаліту, що включає виділення плазми або сироватки з крові людей і одержання з неї риваноло-етаноловим методом цільового продукту, який відрізняється тим, що відбір людей проводять цілеспрямовано в активних природних вогнищах кліщового енцефаліту серед осіб, перехворілих на цю інфекцію, в крові яких вміст специфічних антитіл у титрах складає не нижче 1:40, визначених в реакції...

Штам гібридних клітин mus musculus 156с10 – продуцент моноклональних антитіл до імуноглобуліну людини класу g

Завантаження...

Номер патенту: 14890

Опубліковано: 15.06.2006

Автори: Шевчук Олександр Анатолієвич, Іванська Наіля Валєєвна, Донська Євгенія Сергіївна, Пилипенко Віталій Григорович, Співак Микола Якович, Терещенко Михайло Іванович, Касьяненко Тетяна Вальтерівна, Горлов Юрій Іванович, Раєвська Галина Євгенівна, Ніколаєнко Ігор Васильович, Галкін Олександр Юрійович, Костенко Іріна Григоріївна, Семиноженко Володимир Петрович

МПК: A61K 39/395, C12N 5/20

Мітки: моноклональних, антитіл, клітин, класу, штам, гібридних, імуноглобуліну, 156с10, musculus, продуцент, людини

Формула / Реферат:

Штам гібридних клітин 156С10 - продуцент моноклональних антитіл до імуноглобулінів людини класу G, які належать до G2b імуноглобулінів, мають константу афінності  М, титр у непрямому імуноферментному аналізі (ІФА) Τ=1000, і придатні для використання як основи для імуноферментних кон'югатів у діагностичних тест-системах.

Імуноферментна тест-система для визначення вмісту загального імуноглобуліну е в сироватці крові

Завантаження...

Номер патенту: 75920

Опубліковано: 15.06.2006

Автори: Прилуцька Ольга Олександрівна, Прилуцький Олександр Сергійович

МПК: A61B 5/145

Мітки: сироватці, вмісту, крові, визначення, загального, імуноферментна, тест-система, імуноглобуліну

Формула / Реферат:

Імуноферментна тест-система для визначення вмісту загального імуноглобуліну Е в сироватці крові, що включає сорбований планшет з моноклональними антитілами і кон'югата, яка відрізняється тим, що моноклональні антитіла сорбовані при рН 9,8-10,0 у концентрації 10-15 мкг/мл.

Спосіб отримання специфічного імуноглобуліну противірусних інфекцій “поліімуноглобулін людський донорський”

Завантаження...

Номер патенту: 67984

Опубліковано: 15.07.2004

Автори: Кнестяпін Володимир Миколайович, Степанчук Валентин Андрійович, Процап Олена Іванівна, Волковська Людмила Василівна, Марічев Ігор Леонідович

МПК: G01N 33/531

Мітки: специфічного, донорський, інфекцій, імуноглобуліну, противірусних, поліімуноглобулін, отримання, людський, спосіб

Формула / Реферат:

Спосіб отримання специфічного імуноглобуліну противірусних інфекцій шляхом етанолового фракціонування на холоді донорської плазми крові, причому цільовий продукт виділяють з плазми фенотипу АВО груп крові навмисно неімунізованих донорів, з титрами специфічних антитіл, що фільтрують, освітлюють і стерилізують, який відрізняється тим, що отримують кінцевий продукт у вигляді 10 % розчину за протеїном, який виділяють із застосуванням...

Спосіб експрес-діагностики вірусу інфекційної анемії коней за допомогою флуоресціюючого імуноглобуліну

Завантаження...

Номер патенту: 64896

Опубліковано: 15.03.2004

Автори: Старчеус Анатолій Павлович, Матвієнко Наталія Миколаївна, Степанчук Валентин Андрійович

МПК: G01N 21/64, C07K 14/155, G01N 33/533 ...

Мітки: інфекційної, імуноглобуліну, коней, вірусу, допомогою, спосіб, експрес-діагностики, флуоресціюючого, анемії

Формула / Реферат:

Спосіб експрес-діагностики вірусу інфекційної анемії коней за допомогою флуоресціюючого імуноглобуліну, який відрізняється тим, що алогенний імуноглобулін проти вірусу інфекційної анемії коней з'єднують з люмінуючим барвником, цей комплекс наносять на досліджуваний матеріал і за наявності специфічної люмінесценції експрес-методом визначають антиген вірусу інфекційної анемії коней.

Прискорений спосіб діагностики класичної чуми свиней з використанням кролячого антисвинячого імуноглобуліну g, міченого пероксидазою хріну

Завантаження...

Номер патенту: 58868

Опубліковано: 15.08.2003

Автори: Шиков Олександр Тихонович, Ситюк Микола Петрович, Собко Юрій Анатолійович, Білоконь Валерій Іванович

МПК: G01N 33/535

Мітки: прискорений, чуми, класичної, імуноглобуліну, антисвинячого, міченого, хріну, використанням, свиней, пероксидазою, діагностики, кролячого, спосіб

Формула / Реферат:

1. Прискорений спосіб діагностики класичної чуми свиней (КЧС) з використанням кролячого антисвинячого імуноглобуліну G, міченого пероксидазою хріну, який включає підготовку мазків-відбитків патологічного матеріалу і їх фіксацію, фарбування клітин мазків, виявлення клітин, уражених вірусом класичної чуми свиней, який відрізняється тим, що мазки-відбитки патологчного матеріалу готують у лунках пластикового планшета з внесенням гіперімунної...

Спосіб отримання протилептоспірозного імуноглобуліну

Завантаження...

Номер патенту: 44667

Опубліковано: 15.02.2002

Автори: Васильєва Наталя Аврумівна, Юнка Наталя Романівна, Лучанко Петро Іванович, Назарчук Лідія Василівна, Андрейчин Михайло Антонович

МПК: A61K 35/16, A61K 39/395

Мітки: спосіб, отримання, протилептоспірозного, імуноглобуліну

Формула / Реферат:

Спосіб отримання протилептоспірозного імуноглобуліну з гамма-глобулінової фракції крові, що містить протилептоспірозні антитіла, який відрізняється тим, що протилептоспірозний імуноглобулін отримують із крові людей-донорів.

Спосіб одержання антирабічного імуноглобуліну

Завантаження...

Номер патенту: 36650

Опубліковано: 16.04.2001

Автори: Антонова Людмила Олександрівна, Щербак Юрій Миколаєвич

МПК: A61K 39/42

Мітки: одержання, імуноглобуліну, спосіб, антирабічного

Формула / Реферат:

Спосіб одержання антирабічного імуноглобуліну, який включає вакцинацію донорів концентрованою культуральною антирабічною вакциною (КоКАВ), забір у них крові, виділення плазми шляхом плазмаферезу і одержання з неї спиртово-риваноловим методом цільового продукту, який відрізняється тим, що відбір донорів проводять цілеспрямовано серед здорових осіб 18-50 років, вакцину вводять п'ятиразово в дельтовидний м'яз по 1,0мл в 1, 3, 7, 15 і 30 дні з...

Спосіб одержання антидифтерійного імуноглобуліну

Завантаження...

Номер патенту: 22426

Опубліковано: 03.03.1998

Автори: Мельник Олена Анатоліївна, Федоровська Олена Олексіївна, Погодаєва Лариса Костянтинівна, Степанчук Валентин Андрійович, Перехрестенко Петро Михайлович, Назарчук Лідія Василівна

Мітки: одержання, імуноглобуліну, спосіб, антидифтерійного

Текст:

...донорами, проходят тщательное клинико-лабораторное обследование для определения состояния здоровья и установления пригодности плазмы крови для получения специфического иммуноглобулина. Плазму с титрами антидифтерийных антител от 180 и выше не содержащую HBSAg и антител ВГС, ВИЧ, накапливают при температуре (минус 20 ±5)°С в течение не более 6 месяцев. Получают гамма-глобулиновую фракцию этаноловым методом фракционирования на холоду, На...

Спосіб одержання імуноглобуліну

Завантаження...

Номер патенту: 14124

Опубліковано: 25.04.1997

Автори: Лобунець Константин Антонович, Назарчук Лідія Василівна, Максимець Ала Петрівна, Грузова Людмила Михайлівна, Підгорна Людмила Григорівна, Федоровська Олена Олексіївна

МПК: A61K 35/16

Мітки: спосіб, одержання, імуноглобуліну

Формула / Реферат:

Способ получения иммуноглобулина путем обработки донорской плазмы этанолом, отлича­ющийся тем, что, с целью повышения специфи­ческой активности и термостабильности пре­парата иммуноглобулина против Pseudomonas aeruginosa, целевой продукт выделяют из плазмы крови группы А(II) и 0(1) реконвалесцентов синегнойной инфекции с титром антисинегнойных антител 1:40-1:80 и лиофильно высушивают в те­чение 50-55 ч при температуре в конце сушки...

Спосіб одержання антирабічного імуноглобуліну

Завантаження...

Номер патенту: 11155

Опубліковано: 25.12.1996

Автори: Федоровська Олена Олексіївна, Шинкаренко Ганна Опанасівна, Сєлімов Мідат Обдурахмановіч, Логвінова Валентина Павлівна, Рибальська Алла Петрівна, Соболєв Володимир Федорович

МПК: C07K 16/08, A61K 39/395, A61K 39/205 ...

Мітки: імуноглобуліну, спосіб, одержання, антирабічного

Текст:

...спирта большой ванны фракционного стола понижают до -5 - -6°. Суспензию охлаждают до температуры -1°. В мерник медленно заливают предварительно охлажденный до -15 - -20°С 95% этиловый спирт в количестве 240 мл на 1 литр суспензии. Конечная концентрация спирта в смеси 19%. Смесь перемешивают не менее 2-х часов при температуре -5 - -6°С (созревание осадка) Затем осадок отделяют центрифугированием в стаканчиковых рефрижераторных центрифугах при...

Спосіб одержання протигрипозного імуноглобуліну людини

Завантаження...

Номер патенту: 3974

Опубліковано: 27.12.1994

Автори: Поздняков Сергій Васильович, Рибакова Тетяна Михайлівна, Безброж Ігор Моїсейович, Скрипченко Георгій Степанович, Малікова Майя Василівна

МПК: A61K 39/395, C07K 16/08, A61K 39/145 ...

Мітки: людини, спосіб, імуноглобуліну, одержання, протигрипозного

Формула / Реферат:

Способ получения противогриппозного иммуноглобулина человека, включающий иммунизацию доноров гриппозной вакциной с последующим отбором иммунной плазмы с помощью плазмофореза и фракционирования плазмы, отличающийся тем, что иммунизацию осуществляют гриппозной вакциной, полученной из штамма-варианта 4/1-А (Хабаровск) 74/77.