Є ще 304 сторінки.

Дивитися все сторінки або завантажити PDF файл.

Формула / Реферат

1. Антитіло, що включає антигензв’язувальний домен, який зв’язується з людським IL-12 і людським IL-23, де зазначене антитіло містить

3 послідовності CDR важкого ланцюга, вибрані з:

HCDR1: DYYX1H, де:

X1=M або L;

HCDR2: WIDPENGDTEX2APKFQG, де:

X2=Y, H або S;

HCDR3: X3KELRYFDV, де:

X3=C, A, N, D, E, Q, G, H, I, L, P або V,

і 3 послідовності CDR легкого ланцюга, вибрані з:

LCDR1: RAX4X5SISINLH, де:

X4=S або P;

X5=Q або R;

LCDR2: FAX6QSX7S, де:

X6=S або R;

X7=I або T;

LCDR3: QQSNSX8PLT, де:

X8=W або F.

2. Антитіло за п. 1, де зазначене антитіло також містить послідовність акцепторної каркасної ділянки людського важкого ланцюга, вибрану із групи, що складається з SEQ ID NO: 202, SEQ ID NO: 205, SEQ ID NO: 208, SEQ ID NO: 203, SEQ ID NO: 206, SEQ ID NO: 209, SEQ ID NO: 204 і SEQ ID NO: 207.

3. Антитіло за п. 1 або 2, де зазначене антитіло також містить послідовність акцепторної каркасної ділянки людського легкого ланцюга, вибрану із групи, що складається з: SEQ ID NO: 210, SEQ ID NO: 213, SEQ ID NO: 216, SEQ ID NO: 211, SEQ ID NO: 214, SEQ ID NO: 212 і SEQ ID NO: 215.

4. Антитіло за п. 1 або 2, де зазначене антитіло також включає акцепторну людську каркасну ділянку, що містить принаймні одну амінокислотну заміну в каркасній ділянці в положенні ключового залишку, де зазначений ключовий залишок вибраний із групи, що складається із залишку, суміжного з CDR; залишку сайта глікозилювання; рідкого залишку; залишку, здатного взаємодіяти із субодиницею p40 людського IL-12; залишку, здатного взаємодіяти з CDR; канонічного залишку; контактного залишку, розташованого між варіабельною ділянкою важкого ланцюга і варіабельною ділянкою легкого ланцюга; залишку, що знаходиться в зоні Верньєра; і залишку, що знаходиться в ділянці, яка перекривається в ділянці, розташованій між CDR1 VH-домену, визначеного за Чотієм, і першою каркасною ділянкою важкого ланцюга, визначеною за Кебатом.

5. Антитіло за п. 1 або 2, де зазначене антитіло також включає акцепторну людську каркасну ділянку, що містить щонайменше одну амінокислотну заміну в каркасній ділянці, де зазначена амінокислотна послідовність каркасної ділянки щонайменше на 65% ідентична послідовності зазначеної людської акцепторної каркасної ділянки і містить принаймні 70 амінокислотних залишків, ідентичних амінокислотним залишкам зазначеної людської акцепторної каркасної ділянки.

6. Антитіло за п. 1 або 2, де зазначене антитіло також включає варіабельну ділянку важкого ланцюга імуноглобуліну, вибрану з групи, що складається з SEQ ID NO: 6, SEQ ID NO: 62, SEQ ID NO: 114, SEQ ID NO: 142, SEQ ID NO: 28, SEQ ID NO: 87, SEQ ID NO: 115, SEQ ID NO: 143, SEQ ID NO: 29, SEQ ID NO: 88, SEQ ID NO: 116, SEQ ID NO: 144, SEQ ID NO: 30, SEQ ID NO: 90, SEQ ID NO: 117, SEQ ID NO: 145, SEQ ID NO: 31, SEQ ID NO: 91, SEQ ID NO: 118, SEQ ID NO: 146, SEQ ID NO: 33, SEQ ID NO: 92, SEQ ID NO: 119, SEQ ID NO: 147, SEQ ID NO: 34, SEQ ID NO: 93, SEQ ID NO: 120, SEQ ID NO: 148, SEQ ID NO: 35, SEQ ID NO: 94, SEQ ID NO: 122, SEQ ID NO: 149, SEQ ID NO: 36, SEQ ID NO: 95, SEQ ID NO: 124, SEQ ID NO: 150, SEQ ID NO: 38, SEQ ID NO: 96, SEQ ID NO: 125, SEQ ID NO: 151, SEQ ID NO: 39, SEQ ID NO: 97, SEQ ID NO: 126, SEQ ID NO: 152, SEQ ID NO: 40, SEQ ID NO: 99, SEQ ID NO: 127, SEQ ID NO: 153, SEQ ID NO: 41, SEQ ID NO: 100, SEQ ID NO: 128, SEQ ID NO: 154, SEQ ID NO: 42, SEQ ID NO: 101, SEQ ID NO: 129, SEQ ID NO: 155, SEQ ID NO: 43, SEQ ID NO: 102, SEQ ID NO: 130, SEQ ID NO: 156, SEQ ID NO: 44, SEQ ID NO: 103, SEQ ID NO: 131, SEQ ID NO: 157, SEQ ID NO: 45, SEQ ID NO: 104, SEQ ID NO: 132, SEQ ID NO: 158, SEQ ID NO: 53, SEQ ID NO: 105, SEQ ID NO: 133, SEQ ID NO: 159, SEQ ID NO: 54, SEQ ID NO: 106, SEQ ID NO: 134, SEQ ID NO: 160, SEQ ID NO: 55, SEQ ID NO: 107, SEQ ID NO: 135, SEQ ID NO: 161, SEQ ID NO: 56, SEQ ID NO: 108, SEQ ID NO: 136, SEQ ID NO: 162, SEQ ID NO: 57, SEQ ID NO: 109, SEQ ID NO: 137, SEQ ID NO: 163, SEQ ID NO: 58, SEQ ID NO: 110, SEQ ID NO: 138, SEQ ID NO: 164, SEQ ID NO: 59, SEQ ID NO: 111, SEQ ID NO: 139, SEQ ID NO: 165, SEQ ID NO: 60, SEQ ID NO: 112, SEQ ID NO: 140, SEQ ID NO: 166, SEQ ID NO: 61, SEQ ID NO: 113, SEQ ID NO: 141 і SEQ ID NO: 167.

7. Антитіло за п. 1 або 2, де зазначене антитіло також включає варіабельну ділянку легкого ланцюга імуноглобуліну, вибрану з групи, що складається з SEQ ID NO: 7, SEQ ID NO: 169, SEQ ID NO: 181, SEQ ID NO: 193, SEQ ID NO: 32, SEQ ID NO: 170, SEQ ID NO: 182, SEQ ID NO: 194, SEQ ID NO: 37, SEQ ID NO: 171, SEQ ID NO: 183, SEQ ID NO: 195, SEQ ID NO: 42, SEQ ID NO: 172, SEQ ID NO: 184, SEQ ID NO: 196, SEQ ID NO: 46, SEQ ID NO: 173, SEQ ID NO: 185, SEQ ID NO: 197, SEQ ID NO: 47, SEQ ID NO: 174, SEQ ID NO: 186, SEQ ID NO: 198, SEQ ID NO: 48, SEQ ID NO: 175, SEQ ID NO: 187, SEQ ID NO: 199, SEQ ID NO: 49, SEQ ID NO: 176, SEQ ID NO: 188, SEQ ID NO: 200, SEQ ID NO: 50, SEQ ID NO: 177, SEQ ID NO: 189, SEQ ID NO: 201, SEQ ID NO: 51, SEQ ID NO: 178, SEQ ID NO: 190, SEQ ID NO: 52, SEQ ID NO: 179 і SEQ ID NO: 192.

8. Антитіло за п. 1, де зазначене антитіло включає дві варіабельні ділянки імуноглобуліну, де зазначені дві варіабельні ділянки імуноглобуліну вибрані з групи, що складається з:

SEQ ID NO: 6 і SEQ ID NO: 7, SEQ ID NO: 6 і SEQ ID NO: 169, SEQ ID NO: 28 і SEQ ID NO: 179, SEQ ID NO: 29 і SEQ ID NO: 179, SEQ ID NO: 30 і SEQ ID NO: 179, SEQ ID NO: 31 і SEQ ID NO: 32, SEQ ID NO: 33 і SEQ ID NO: 179, SEQ ID NO: 34 і SEQ ID NO: 51, SEQ ID NO: 34 і SEQ ID NO: 47, SEQ ID NO: 35 і SEQ ID NO: 179, SEQ ID NO: 36 і SEQ ID NO: 37, SEQ ID NO: 38 і SEQ ID NO: 179, SEQ ID NO: 38 і SEQ ID NO: 51, SEQ ID NO: 38 і SEQ ID NO: 32, SEQ ID NO: 38 і SEQ ID NO: 47, SEQ ID NO: 38 і SEQ ID NO: 52, SEQ ID NO: 39 і SEQ ID NO: 179, SEQ ID NO: 40 і SEQ ID NO: 179, SEQ ID NO: 41 і SEQ ID NO: 42, SEQ ID NO: 43 і SEQ ID NO: 179, SEQ ID NO: 44 і SEQ ID NO: 179, SEQ ID NO: 44 і SEQ ID NO: 51, SEQ ID NO: 44 і SEQ ID NO: 32, SEQ ID NO: 44 і SEQ ID NO: 47, SEQ ID NO: 44 і SEQ ID NO: 52, SEQ ID NO: 45 і SEQ ID NO: 179, SEQ ID NO: 54 і SEQ ID NO: 179, SEQ ID NO: 55 і SEQ ID NO: 179, SEQ ID NO: 56 і SEQ ID NO: 179, SEQ ID NO: 57 і SEQ ID NO: 179, SEQ ID NO: 58 і SEQ ID NO: 42, SEQ ID NO: 59 і SEQ ID NO: 179, SEQ ID NO: 60 і  SEQ ID NO: 179, SEQ ID NO: 61 і SEQ ID NO: 42, SEQ ID NO: 62 і SEQ ID NO: 42, SEQ ID NO: 87 і SEQ ID NO: 7, SEQ ID NO: 88 і SEQ ID NO: 7, SEQ ID NO: 90 і SEQ ID NO: 7, SEQ ID NO: 91 і SEQ ID NO: 7, SEQ ID NO: 92 і SEQ ID NO: 7, SEQ ID NO: 93 і SEQ ID NO: 7, SEQ ID NO: 94 і SEQ ID NO: 7, SEQ ID NO: 95 і SEQ ID NO: 7, SEQ ID NO: 96 і SEQ ID NO: 7, SEQ ID NO: 97 і SEQ ID NO: 7, SEQ ID NO: 99 і SEQ ID NO: 7, SEQ ID NO: 100 і SEQ ID NO: 7, SEQ ID NO: 101 і SEQ ID NO: 7, SEQ ID NO: 102 і SEQ ID NO: 7, SEQ ID NO: 103 і SEQ ID NO: 7, SEQ ID NO: 104 і SEQ ID NO: 7, SEQ ID NO: 105 і SEQ ID NO: 7, SEQ ID NO: 106 і SEQ ID NO: 171, SEQ ID NO: 106 і SEQ ID NO: 172, SEQ ID NO: 107 і SEQ ID NO: 171, SEQ ID NO: 107 і SEQ ID NO: 172, SEQ ID NO: 108 і SEQ ID NO: 171, SEQ ID NO: 108 і SEQ ID NO: 172, SEQ ID NO: 109 і SEQ ID NO: 170, SEQ ID NO: 110 і SEQ ID NO: 171, SEQ ID NO: 111 і SEQ ID NO: 172, SEQ ID NO: 112 і SEQ ID NO: 169, SEQ ID NO: 113 і SEQ ID NO: 173, SEQ ID NO: 113 і SEQ ID NO: 174, SEQ ID NO: 113 і SEQ ID NO: 175, SEQ ID NO: 113 і SEQ ID NO: 176, SEQ ID NO: 113 і SEQ ID NO: 177, SEQ ID NO: 113 і SEQ ID NO: 176, SEQ ID NO: 114 і SEQ ID NO: 173, SEQ ID NO: 114 і SEQ ID NO: 174, SEQ ID NO: 114 і SEQ ID NO: 175, SEQ ID NO: 114 і SEQ ID NO: 176, SEQ ID NO: 114 і SEQ ID NO: 177, SEQ ID NO: 115 і SEQ ID NO: 173, SEQ ID NO: 115 і SEQ ID NO: 174, SEQ ID NO: 115 і SEQ ID NO: 175, SEQ ID NO: 115 і SEQ ID NO: 176, SEQ ID NO: 115 і SEQ ID NO: 177, SEQ ID NO: 115 і SEQ ID NO: 181, SEQ ID NO: 115 і SEQ ID NO: 182, SEQ ID NO: 115 і SEQ ID NO: 183, SEQ ID NO: 115 і SEQ ID NO: 184, SEQ ID NO: 115 і SEQ ID NO: 185, SEQ ID NO: 115 і SEQ ID NO: 186, SEQ ID NO: 115 і SEQ ID NO: 187, SEQ ID NO: 115 і SEQ ID NO: 188, SEQ ID NO: 115 і SEQ ID NO: 189, SEQ ID NO: 115 і SEQ ID NO: 190, SEQ ID NO: 115 і SEQ ID NO: 192, SEQ ID NO: 115 і SEQ ID NO: 193, SEQ ID NO: 115 і SEQ ID NO: 194, SEQ ID NO: 115 і SEQ ID NO: 195, SEQ ID NO: 115 і SEQ ID NO: 196, SEQ ID NO: 115 і SEQ ID NO: 197, SEQ ID NO: 115 і SEQ ID NO: 198, SEQ ID NO: 115 і SEQ ID NO: 199, SEQ ID NO: 115 і SEQ ID NO: 200, SEQ ID NO: 115 і SEQ ID NO: 201, SEQ ID NO: 116 і SEQ ID NO: 173, SEQ ID NO: 116 і SEQ ID NO: 174, SEQ ID NO: 116 і SEQ ID NO: 175, SEQ ID NO: 116 і SEQ ID NO: 176, SEQ ID NO: 116 і SEQ ID NO: 177, SEQ ID NO: 117 і SEQ ID NO: 173, SEQ ID NO: 117 і SEQ ID NO: 174, SEQ ID NO: 117 і SEQ ID NO: 175, SEQ ID NO: 117 і SEQ ID NO: 176, SEQ ID NO: 117 і SEQ ID NO: 177, SEQ ID NO: 118 і SEQ ID NO: 178, SEQ ID NO: 118 і SEQ ID NO: 179, SEQ ID NO: 119 і SEQ ID NO: 178, SEQ ID NO: 119 і SEQ ID NO: 179, SEQ ID NO: 119 і SEQ ID NO: 51, SEQ ID NO: 119 і SEQ ID NO: 189, SEQ ID NO: 119 і SEQ ID NO: 46, SEQ ID NO: 119 і SEQ ID NO: 47, SEQ ID NO: 119 і SEQ ID NO: 48, SEQ ID NO: 119 і SEQ ID NO: 49, SEQ ID NO: 119 і SEQ ID NO: 50, SEQ ID NO: 119 і SEQ ID NO: 51, SEQ ID NO: 119 і SEQ ID NO: 52, SEQ ID NO: 120 і SEQ ID NO: 178, SEQ ID NO: 120 і SEQ ID NO: 179, SEQ ID NO: 122 і SEQ ID NO: 176, SEQ ID NO: 124 і SEQ ID NO: 176, SEQ ID NO: 125 і SEQ ID NO: 176, SEQ ID NO: 126 і SEID NO: 176, SEQ ID NO: 127 і SEQ ID NO: 176, SEQ ID NO: 128 і SEQ ID NO: 176, SEQ ID NO: 129 і SEQ ID NO: 176, SEQ ID NO: 130 і SEQ ID NO: 176, SEQ ID NO: 131 і SEQ ID NO: 176, SEQ ID NO: 132 і SEQ ID NO: 176, SEQ ID NO: 133 і SEQ ID NO: 176, SEQ ID NO: 134 і SEQ ID NO: 176, SEQ ID NO: 135 і SEQ ID NO: 176, SEQ ID NO: 136 і SEQ ID NO: 176, SEQ ID NO: 137 і SEQ ID NO: 176, SEQ ID NO: 138 і SEQ ID NO: 176, SEQ ID NO: 139 і SEQ ID NO: 176, SEQ ID NO: 140 і SEQ ID NO: 176, SEQ ID NO: 141 і SEQ ID NO: 176, SEQ ID NO: 142 і SEQ ID NO: 176, SEQ ID NO: 143 і SEQ ID NO: 176, SEQ ID NO: 144 і SEQ ID NO: 176, SEQ ID NO: 145 і SEQ ID NO: 176, SEQ ID NO: 146 і SEQ ID NO: 176, SEQ ID NO: 147 і SEQ ID NO: 176, SEQ ID NO: 148 і SEQ ID NO: 176, SEQ ID NO: 149 і SEQ ID NO: 176, SEQ ID NO: 150 і SEQ ID NO: 176, SEQ ID NO: 151 і SEQ ID NO: 176, SEQ ID NO: 152 і SEQ ID NO: 176, SEQ ID NO: 153 і SEQ ID NO: 189, SEQ ID NO: 154 і SEQ ID NO: 189, SEQ ID NO: 155 і SEQ ID NO: 189, SEQ ID NO: 156 і SEQ ID NO: 189, SEQ ID NO: 157 і SEQ ID NO: 189, SEQ ID NO: 158 і SEQ ID NO: 189, SEQ ID NO: 159 і SEQ ID NO: 189, SEQ ID NO: 160 і SEQ ID NO: 189, SEQ ID NO: 161 і SEQ ID NO: 189, SEQ ID NO: 161 і SEQ ID NO: 179, SEQ ID NO: 162 і SEQ ID NO: 189, SEQ ID NO: 162 і SEQ ID NO: 179, SEQ ID NO: 163 і SEQ ID NO: 189, SEQ ID NO: 163 і SEQ ID NO: 179, SEQ ID NO: 164 і SEQ ID NO: 189, SEQ ID NO: 164 і SEQ ID NO: 179, SEQ ID NO: 165 і SEQ ID NO: 189, SEQ ID NO: 165 і SEQ ID NO: 179, SEQ ID NO: 166 і SEQ ID NO: 189, SEQ ID NO: 166 і SEQ ID NO: 179, SEQ ID NO: 167 і SEQ ID NO: 189, SEQ ID NO: 167 і SEQ ID NO: 179, SEQ ID NO: 168 і SEQ ID NO: 189.

9. Антитіло за будь-яким з пп. 1-8, де вказане антитіло зв′язується з людським IL-12p40, що присутній у вигляді мономера (людським IL-12p40) і у вигляді гомодимера (людським IL-12p80), і де зазначене антитіло інгібує зв′язування людського IL-12 з людським IL-12Rb2 і людського IL-23 з людським IL-23R, але не інгібує зв′язування людського IL-12 або людського IL-23, або людського IL-12p40, або людського IL-12p80 із людським IL-12Rb1.

10. Антитіло за будь-яким з пп. 1-9, де зазначене антитіло конкурує за зв′язування з людським IL-12 і/або з людським IL-23 з антитілом, що містить варіабельну ділянку важкого ланцюга, що має послідовність SEQ ID NO: 6.

11. Антитіло за будь-яким з пп. 1-10, де зазначене антитіло конкурує за зв’язування з людським IL-12 і/або з людським IL-23 з антитілом, що містить варіабельну ділянку легкого ланцюга, що має послідовність SEQ ID NO: 7.

12. Антитіло за будь-яким з пп. 1-11, де зазначене антитіло зв′язується з частиною людського IL-12p40, що має послідовність VQVQGKSKREKKDRVFTDKTSATVICRKNASISV (SEQ ID NO: 65).

13. Антитіло за будь-яким з пп. 1-12, де зазначене антитіло специфічно зв′язується з людським IL-12p40 (SEQ ID NO: 1) у положенні Asp 265.

14. Антитіло за будь-яким з пп. 1-8, де рівень зв′язування зазначеного антитіла з людським IL-23 (SEQ ID NO: 66) перевищує рівень зв′язування зазначеного антитіла з мутантним IL-23 D265A (SEQ ID NO: 75).

15. Антитіло за будь-яким із пп. 1-14, де зазначене антитіло містить константну ділянку важкого ланцюга імуноглобуліну людини або примата, що не є людиною, і де зазначене антитіло вибране з групи, що складається з IgG1, IgG2, IgG3, IgG4, IgM, IgE і IgA.

16. Антитіло за будь-яким із пп. 1-14, де зазначене антитіло містить константну ділянку легкого ланцюга імуноглобуліну людини або примата, що не є людиною, і де зазначене антитіло вибране з групи, що складається з ланцюгів каппа або лямбда.

17. Антитіло за будь-яким із пп. 1-16, де зазначене антитіло модифіковане за допомогою ковалентного зв′язування з органічною молекулою.

18. Антитіло за п. 17, де зазначеною органічною молекулою є пряма або розгалужена гідрофільна полімерна група, група жирної кислоти або складноефірна група жирної кислоти.

19. Антитіло за будь-яким із пп. 1-16, де зазначене антитіло модифікують із метою модуляції функціональних властивостей, вибраних із групи, що складається з антитілозалежної клітинної цитотоксичності, комплементзалежної цитотоксичності, часу напівжиття в сироватці, біологічного розподілу і зв′язування з Fc-рецепторами.

20. Антитіло за п. 19, де зазначену модифікацію здійснюють шляхом конструювання білків, конструювання вуглеводів або хімічними методами.

21. Молекула нуклеїнової кислоти, де зазначена нуклеїнова кислота кодує домен VH антитіла за будь-яким із пп. 1-8.

22. Молекула нуклеїнової кислоти за п. 21, де зазначена нуклеїнова кислота має послідовність, вибрану з:

SEQ ID NO: 217, SEQ ID NO: 218, SEQ ID NO: 219, SEQ ID NO: 220, SEQ ID NO: 222, SEQ ID NO: 223, SEQ ID NO: 224, SEQ ID NO: 225, SEQ ID NO: 227, SEQ ID NO: 228, SEQ ID NO: 229, SEQ ID NO: 230, SEQ ID NO: 232, SEQ ID NO: 233, SEQ ID NO: 234, SEQ ID NO: 242, SEQ ID NO: 243, SEQ ID NO: 244, SEQ ID NO: 245, SEQ ID NO: 246, SEQ ID NO: 247, SEQ ID NO: 248, SEQ ID NO: 249, SEQ ID NO: 250, SEQ ID NO: 251, SEQ ID NO: 252, SEQ ID NO: 254, SEQ ID NO: 255, SEQ ID NO: 257, SEQ ID NO: 258, SEQ ID NO: 259, SEQ ID NO: 260, SEQ ID NO: 261, SEQ ID NO: 262, SEQ ID NO: 263, SEQ ID NO: 264, SEQ ID NO: 266, SEQ ID NO: 267, SEQ ID NO: 268, SEQ ID NO: 269, SEQ ID NO: 270, SEQ ID NO: 271, SEQ ID NO: 272, SEQ ID NO: 273, SEQ ID NO: 274, SEQ ID NO: 275, SEQ ID NO: 276, SEQ ID NO: 277, SEQ ID NO: 278, SEQ ID NO: 279, SEQ ID NO: 280, SEQ ID NO: 281, SEQ ID NO: 282, SEQ ID NO: 283, SEQ ID NO: 284, SEQ ID NO: 285, SEQ ID NO: 286, SEQ ID NO: 287, SEQ ID NO: 289, SEQ ID NO: 291, SEQ ID NO: 292, SEQ ID NO: 293, SEQ ID NO: 294, SEQ ID NO: 295, SEQ ID NO: 296, SEQ ID NO: 297, SEQ ID NO: 298, SEQ ID NO: 299, SEQ ID NO: 300, SEQ ID NO: 301, SEQ ID NO: 302, SEQ ID NO: 303, SEQ ID NO: 304, SEQ ID NO: 305, SEQ ID NO: 306, SEQ ID NO: 307, SEQ ID NO: 308, SEQ ID NO: 309, SEQ ID NO: 310, SEQ ID NO: 311, SEQ ID NO: 312, SEQ ID NO: 313, SEQ ID NO: 314, SEQ ID NO: 315, SEQ ID NO: 316, SEQ ID NO: 317, SEQ ID NO: 318, SEQ ID NO: 319, SEQ ID NO: 320, SEQ ID NO: 321, SEQ ID NO: 322, SEQ ID NO: 323, SEQ ID NO: 324, SEQ ID NO: 325, SEQ ID NO: 326, SEQ ID NO: 327, SEQ ID NO: 328, SEQ ID NO: 329, SEQ ID NO: 330, SEQ ID NO: 331, SEQ ID NO: 332, SEQ ID NO: 333, SEQ ID NO: 334, SEQ ID NO: 335.

23. Молекула нуклеїнової кислоти, де зазначена нуклеїнова кислота кодує домен антитіла VL за будь-яким із пп. 1-8.

24. Молекула нуклеїнової кислоти за п. 23, де зазначена нуклеїнова кислота має послідовність, вибрану з:

SEQ ID NO: 221, SEQ ID NO: 226, SEQ ID NO: 231, SEQ ID NO: 235, SEQ ID NO: 236, SEQ ID NO: 237, SEQ ID NO: 238, SEQ ID NO: 239, SEQ ID NO: 240, SEQ ID NO: 241, SEQ ID NO: 336, SEQ ID NO: 338, SEQ ID NO: 339, SEQ ID NO: 340, SEQ ID NO: 341, SEQ ID NO: 342, SEQ ID NO: 343, SEQ ID NO: 344, SEQ ID NO: 345, SEQ ID NO: 346, SEQ ID NO: 347, SEQ ID NO: 348, SEQ ID NO: 350, SEQ ID NO: 351, SEQ ID NO: 352, SEQ ID NO: 353, SEQ ID NO: 354, SEQ ID NO: 355, SEQ ID NO: 356, SEQ ID NO: 357, SEQ ID NO: 358, SEQ ID NO: 359, SEQ ID NO: 361, SEQ ID NO: 362, SEQ ID NO: 363, SEQ ID NO: 364, SEQ ID NO: 365, SEQ ID NO: 366, SEQ ID NO: 367, SEQ ID NO: 368, SEQ ID NO: 369, SEQ ID NO: 370.

25. Застосування антитіла за будь-яким із пп. 1-20 для приготування лікарського засобу для лікування захворювання, вибраного з групи, що складається з ревматоїдного артриту, остеоартриту, реактивного артриту, псоріатичного артриту, втрати кісткової тканини, гіперчутливості дихальних шляхів, хронічної обструктивної хвороби легенів, демієлінізуючого захворювання, псоріазу, розсіяного склерозу, гіперчутливості шкіри, гострого і хронічного відторгнення трансплантата, відторгнення алотрансплантата, реакції ″трансплантат проти хазяїна″, системного склерозу, системного червоного вовчака, аутоімунного запального захворювання кишечнику, запального захворювання сечостатевих шляхів, серцево-судинного захворювання, васкулітів, переміжної лихоманки, порушення метаболізму глюкози, хвороби легенів, раку, періодонтиту, герпетичного стромального кератиту, алергії, запального болю, спондилоартропатії, септицемії, септичного або ендотоксичного шоку, менінгіту, хірургічної травми, аутоімунної хвороби крові, хвороби Альцгеймера, саркоїдозу, цирозу, гепатиту (включаючи аутоімунний гепатит), первинного біліарного цирозу, увеїту, тиреоїдиту, атеросклерозу, алопеції, хвороби Вільсона, гломерулонефриту і дисліпідемії.

Текст

Реферат: Винахід належить до антитіла, що включає антигензв′язувальний домен, який зв′язується з людським IL-12 і людським IL-23. Також винахід належить до молекул нуклеїнової кислоти, застосування антитіл, що включає антигензв′язувальний домен, який зв′язується з людським IL12 і людським IL-23 для приготування лікарського засобу. UA 104297 C2 ДЕРЖАВНА СЛУЖБА ІНТЕЛЕКТУАЛЬНОЇ ВЛАСНОСТІ УКРАЇНИ UA 104297 C2 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 АНТИТІЛА ПРОТИ IL-12/IL-23 У даній заявці вимагається пріоритет заявки на патент Австралії № 2008904178, поданої 14 серпня 2008 р., і заявки на патент США № 61/089028, поданої 14 серпня 2008 р., зміст яких у всій своїй повноті вводиться в даний опис за допомогою посилання. Галузь, якої стосується винахід Даний винахід стосується антитіл, які зв’язуються з людськими IL-12 і IL-23. Попередній рівень техніки Детальні бібліографічні дані публікацій, зазначених авторами даної заявки, наводяться в алфавітному порядку наприкінці даного опису. В описі даної заявки, посилання на попередній рівень техніки не означають і не повинні розглядатися як підтвердження або як будь-яка форма твердження того, що попередній рівень техніки є частиною рівня техніки, відомого фахівцю в будь-якій країні. Інтерлейкін-12 (також відомий як фактор дозрівання цитотоксичних лімфоцитів або фактор стимуляції клітин-кілерів) являє собою гетеродимерний білок розміром 75 кДа. Цей білок складається із субодиниці p35, яка, у свою чергу, складається з пучка альфа-спіралей і нагадує цитокіни класу I. 11 амінокислот, розташовані з боку С-кінця стосовно C63 у p35, називаються петлею з дисульфідними зв’язками, оскільки ця ділянка містить множину залишків, які контактують із p40, тобто, з іншою субодиницею IL-12, включаючи міжланцюговий дисульфідний зв’язок із C177 у p40. Укладка субодиниці p40 нагадує укладку позаклітинного домену інших рецепторів класу I, таких як рецептор гормону росту (GHR). Субодиниця p40 має три домени, позначені D1, D2 і D3. Кожен домен має β-складчасту структуру, при цьому, домен D2 містить міжланцюговий дисульфідний C177-зв’язок. У цьому домені також є сайт N-зв’язаного глікозилювання (GlcNAc-GlcNAc-маноза, де GlcNAc являє собою N-ацетилглюкозамін)(Yoon et al. 2000, Embo J. 19 3530-41). Інтерлейкін-23 був виявлений зовсім недавно (2000) при пошуку членів сімейства цитокінів зі спіральною структурою, подібною до структури інтерлейкіну-6, у базах даних послідовностей із модельованою на комп’ютері конфігурацією. Цей пошук привів до виявлення нової цитокінової субодиниці, яка була позначена IL-23р19 (р19). Ця субодиниця ко-експресується разом із IL12p40, що призводить до секреції гетеродимерного білка, що називають інтерлейкіном-23 (IL23). Передбачається, що IL-23р19 і IL-12p35 мають схожість, яка полягає в тому, що вони містять пучок із чотирьох спіралей (Oppmann et al. 2000 Immunity 13 715-25). Специфічна дія IL-12 на його клітини-мішені опосередковується комплексом IL-12R, який складається з IL-12Rβ1 (Chua et al. 1994 J. Immunol. 153: 128-36) і IL-12Rβ2 (Presky et al. 1996 Proc. Natl. Acad. Sci. USA 93: 14002-7). Специфічна дія IL-23 на його клітини-мішені опосередковується комплексом IL-23R, який складається з IL-12Rβ1 і IL-23R (Parham et al. 2002 J. Immunol. 168 5699-708). Зв’язування IL-12Rβ1 з IL-12 і IL-23 опосередковується загальною субодиницею p40. Це було продемонстровано в експериментах із конкурентного зв’язування, в яких гомодимер субодиниці p40 (p80) конкурує з IL-12 за зв’язування з IL-12Rβ1. Однак, p80 не чинить якогонебудь впливу на зв’язування IL-12 з IL-12Rβ2 (Presky et al. 1996 Ann. N. Y. Acad. Sci. 795 3903). З цього випливає, що субодиниця p35 або гетеродимерна ділянка контакту IL-12 відповідальна за зв’язування з IL-12Rβ2, і тим самим надає селективність IL-12 стосовно комплексу IL-12R (Trinchieri et al. 2003 Immunity 19 641-4). Аналогічним чином, р19 або гетеродимерна ділянка контакту IL-23 відповідальна за зв’язування з IL-23R, і тим самим надає селективність стосовно комплексу IL-23R. Була детектована передача сигналу між комплексом IL-12R і комплексом IL-23R. IL-12R активує шлях передачі сигналу “кіназа Janus JAK – трансдуктор і активатор сигналу транскрипції” (STAT). Фактична дія IL-12 на клітину обумовлена, головним чином, активацією STAT4 (Kaplan et al. 1996 Nature 382 174-7). Присутність сайта зв’язування з STAT4 на IL-12Rβ2 вказує на те, що цей рецептор відіграє важливу роль у передачі сигналу (Yao et al. 1999 Arch. Biochem. Biophys. 368 147-55). Про це також свідчить кореляція експресії IL-12Rβ2 зі сприйнятливістю клітин TН1 до дії IL-12 (Rogge et al. 1997 J. Exp. Med. 185 825-31). IL-23R активує аналогічні комплекси з IL-12R, такі як шляхи JAK-STAT. STAT3, так само, як і STAT4, але більш явно, індукується шляхом зв’язування IL-23 з IL-23R, а інші присутні ДНК-комплекси фактора транскрипції STAT відрізняються від них (Parham, Chirica et al. 2002 J. Immunol. 168 5699-708). Біологічні функції обох IL-12 і IL-23 відрізняються одна від одної. IL-12 секретується активованими запальними клітинами (моноцитами, макрофагами, нейтрофілами, мікрогліальними клітинами, дендритними клітинами). Було проведене дослідження IL-12, 1 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 головним чином, на його вплив на лімфоцити, хоча може бути також оцінений вплив на клітини інших типів. У процесі запальної відповіді, IL-12 індукує NK-клітини і T-клітини з утворенням інтерферону-γ (IFN-γ). Потім, IL-12, ймовірно в комбінації з IFN-γ, індукує диференціювання Tклітин у клітини TH1. Ця відповідь стимулює клітинну імунну систему і максимізує інактивуючу + дію макрофагів на патогени і проліферацію CD8 -T-клітин (Trinchieri 2003 Nat. Rev. Immunol. 3: 133-46). Надпродукування IL-12 корелює з підвищеною прозапальною активністю і урадженням тканини, що звичайно спостерігається при виробленні автоімунної відповіді (Leonard et al. 1997 Crit Rev. Immunol. 17: 545-53). Порушення регуляції продукування IL-12 призводить до розвитку нижченаведених захворювань, таких як псоріаз (Yawalkar et al. 1998 J Invest Dermatol 111 10537; de Rie 1999 Dermatology 199 101; Shaker et al. 2006 Clin. Biochem. 39 119-25), хвороба Крона (Neurath et al. 1995 J. Exp. Med. 182 1281-90; Simpson et al. 1998 J. Exp. Med. 187 1225-34; Camoglio et al. 2002 Eur. J. Immunol 32 261-9), розсіяний склероз (Fassbender et al. 1998 Neurology 51: 753-8; Laman et al. 1998 J. Neuroimmunol 86, 30-45), ревматоїдний артрит (Kim et al. 2000 Clin. Exp. Immunol. 119 175-81; Leung et al. 2000 J. Immunol. 164 6495-502) та інші автоімунні захворювання. Роль IL-12 у цих захворюваннях поки нез’ясована, однак, вважається, що в розвитку цих захворювань може брати участь надполяризація T H1-відповіді (Gordon et al. 2005 Curr. Opin. Gastroenterol. 21, 431-7). IL-23 секретується активованими людськими макрофагами, а також дендритними клітинами (Verreck et al. 2004, Proc. Natl. Acad. Sci. USA 101 4560-5). IL-23 переважно діє на Т-клітини пам’яті, і було висловлене припущення, що він стимулює розвиток автоімунного захворювання за допомогою регуляції IL-17A і IL-17F, про що свідчить здатність мишачих спленоцитів секретувати IL-17 у відповідь на дію IL-23. У людини є шлях IL-23/IL-17, і було показано, що IL23 є таким же добрим індуктором IL-21, IL-22, IFN-γ, TNF-α як і IL-17 і всі прозапальні цитокіни. In vitro IL-6 і TGF-β1 стимулюють “ненавчені” T-клітини, спрямовуючи їх по недавно відкритому Тклітинному шляху (TH17) (Zhou et al. 2007 Nat. Immunol. 8, 967-74). Ці клітини також запускаються автокринною системою за допомогою секреції IL-21. І нарешті, вважається, що IL23 і/або IL-1β підтримують TH17-відповідь у цих клітинах (див., наприклад, огляд Dong 2008 Nat. Rev. Immunol. 8, 337-48). Крім того, також становить інтерес фактор транскрипції RORγt, що, як було показано, активується у відповідь на дію TH17 (Chen et al. 2007 Arthritis Rheum. 56, 293646). Оскільки обоє IL-12 і IL-23 містять загальну субодиницю, то даний патологічний стан важко приписати тільки лише надпродукуванню одного або іншого інтерлейкіну. Однак, дослідження показали, що порушення регуляції IL-23 призводить до розвитку таких захворювань, як псоріаз (Lee et al. 2004 J. Exp. Med. 199, 125-30; Torti et al. 2007 J. Am. Acad. Dermatol. 57: 1059-68), хвороба Крона (Neurath 2007 Nat. Med. 13 26-8), і розсіяний склероз (Cua et al. 2003 Nature 421 744-8) та інших автоімунних захворювань. IL-12p40 може секретуватися у вигляді мономера (IL-12p40) або гомодимера (IL-12p80), який являє собою дві субодиниці p40, зв’язані разом дисульфідним зв’язком (Gillessen et al. 1995 Eur. J. Immunol. 25 200-6). У мишей із моделлю інсульту ці молекули p40 секретувалися у 50кратному надлишку в порівнянні з IL-12 (Gillessen, Carvajal et al. 1995 Eur. J. Immunol. 25, 200-6), а в людських мононуклеарних клітинах периферичної крові (МКПК) – у 10-20-кратному надлишку (D’Andrea et al. 1992 J. Exp. Med. 176, 1387-98). IL-12p80 може чинити в 20 разів більшу інгібуючу дію на активність IL-12 in vitro, ніж IL-12p40 (Gillessen, Carvajal et al. 1995 Eur. J. Immunol. 25: 200-6). Було показано, що рекомбінантний IL-12p80 зв’язується з IL-12β1 (Wang et al. 1999 Eur. J. Immunol. 29, 2007-13). Вважається, що IL-12p40/p80 є антагоністом комплексу рецепторів IL-12/23, оскільки було виявлено, що рекомбінантний мишачий IL-12p80 (rmIL-12p80) конкурує з IL-12/23 за зв’язування з IL-12Rβ1 in vivo і in vitro (Mattner et al. 1993 Eur. J. Immunol. 23, 2202-8; Gillessen, Carvajal et al. 1995 Eur. J. Immunol. 25 200-6; Gately et al. 1996 Ann. N. Y. Acad. Sci. 795 1-12). Було також показано, що гомодимер попереджає IL-12-опосередкований інсульт у мишачої моделі (Mattner et al. 1997 Infect Immun. 65, 4734-7). У дослідженнях на IL-23-опосередковані імунологічні функції, IL-12p40 пригнічував IL-23-індуковане продукування цитокінів за допомогою конкурентного зв’язування з IL-12Rβ1 (Shimozato et al. 2006 Immunology 117, 22-8). Зовсім недавно було виявлено, що IL-12p40 або IL-12p80 відіграють і інші біологічні ролі. Однією з раніше встановлених активностей IL-12p80 є його хемоатрактантна дія на макрофаги. Макрофаги, дефіцитні по IL-12Rβ1, але не макрофаги, дефіцитні по IL-12Rβ2 або IL-12p35, мають знижену хемоатрактивну відповідь на rmIL-12p80, що вказує на те, що IL-12Rβ1 опосередковують відповіді на IL-12p80 за відсутності IL-12Rβ2, і що активність IL-12p80 не залежить від IL-12 (Russell et al. 2003 J. Immunol. 171, 6866-74). IL-12p80 може також діяти як індуктор міграції дендритних клітин (ДК). Дендритні клітини (ДК), дефіцитні по IL-12p40, не 2 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 здатні мігрувати з легенів у лімфовузли у відповідь на інфікування мікобактеріями. Той факт, що втрата обох IL-12p35 і IL-23р19 не впливає на здатність активованих мікобактеріями ДК мігрувати у відповідь на дію хемокінів і запускати розмноження Т-клітин, вказує на унікальну роль IL-12p40 (Khader et al. 2006 J. Exp. Med. 203, 1805-15). Було також показано, що IL-12p40 і + IL-12p80 опосередковують запальні відповіді в легенях та індукують продукування IFN-γ CD8 -Tклітинами (Cooper et al. 2007 Trends Immunol. 28, 33-8). Оскільки IL-12 і IL-23 беруть участь у розвитку різних розладів, було розроблено кілька терапевтичних стратегій, спрямованих на інгібування активності IL-12 і/або IL-23. Деякими з описаних раніше антитіл є мишачі моноклональні антитіла, секретовані гібридомами мишей, імунізованих IL-12 (Strober et al. публікація PCT № WO 97/15327; Gately et al. WO99/37682 A2, Neurath, Fuss et al. 1995 J. Exp. Med. 182 1281-90). Застосування цих мишачих антитіл для лікування людини є обмеженим через проблеми, пов’язані з введенням мишачого імуноглобуліну людині. Такі проблеми полягають у вироблянні автоантитіл проти мишачого імуноглобуліну, що призводить до його видалення із сироватки і зводить нанівець будь-який терапевтичний ефект. Такому ефекту, відомому як виробляння людського антимишачого антитіла (HAMA), змогли частково запобігти шляхом введення химерних антитіл, які мають мишачу послідовність, обмежену тільки варіабельними ділянками антитіла (Junghans et al. 1990 Cancer Res. 50, 1495-502; Brown et al. 1991 Proc. Natl. Acad. Sci. USA 88, 2663-7). Зазначалося, що химерні антитіла зв’язуються з IL-12 (Perritt et al. публікація заявки PCT № WO 02/097048A2). Антитілами, ще більш схожими на людські антитіла, є “гуманізовані антитіла”, що містять гіперваріабельні ділянки (ділянки, що визначають комплементарність) донорного мишачого антитіла, але мають варіабельні каркасні ділянки, що походять від акцепторного людського антитіла (Jones et al. 1986 Nature 321 522-5, Winter, патент США № 5225539, Queen et al. патент США № 5693761). Такі “гуманізовані” антитіла проти IL-12 і IL-23 описані Lacy et al. у WO 07/005608. Недавно були описані повнорозмірні людські антитіла, що походять від бібліотек представлення, одержаних із людських джерел (Winter et al., патент США № 7306907; MacCafferty et al., патент США № 5969108) або від мишей із людськими імуноглобуліновими трансгенами (Tomizuka et al., патент США № 7041870; Kucherlapati et al., патент США № 5939598). Salfeld і ін. (патент США № 6914128) описали повнорозмірні людські антитіла проти IL-12. На підставі даних про взаємодію з IL-12, IL-23, IL-12p40 і IL-12p80, антитіла можна підрозділити на п’ять широких класів (фігура 1). Перший клас антитіл представляє антитіла, які специфічно взаємодіють із IL-12p40, що є присутнім у IL-12 і IL-23, а також із мономером IL12p40 і гомодимером IL-12p80 (фігура 1.1). Другий клас антитіл представляє антитіла, що специфічно взаємодіють з IL-12p35 (як приклад є антитіло G161-566, описане Devergne et al. 2001 Am. J. Pathol. 159, 1763-76; фігура 1.2). Третій клас антитіл представляє антитіла, що специфічно взаємодіють з IL-12, але не взаємодіють з IL-23, IL-12p35 і IL-12p40 (як приклад є антитіло 20C2, описане D’аndrеа, Rengaraju et al., 1992 J. Exp. Med. 176, 1387-98; фігура 1.3). Четвертий клас антитіл представляє антитіла, що специфічно взаємодіють із IL-23р19 (як приклад є антитіло, описане Presta et al. у WO 2007/027714; фігура 1.4). П’ятий клас антитіл представляє антитіла, що специфічно взаємодіють з IL-23p40, але не взаємодіють із IL-12p40, де в субодиниці IL-12p40 є послідовність, яка знаходиться на поверхні IL-23, але маскується субодиницею IL-12p35 у IL-12 (як приклад є антитіло, описане Benson et al. у патенті США № 7247711; фігура 1.5). У даному винаході описані нові форми антитіл першого класу, що специфічно взаємодіють з IL-12p40, IL-12p80, IL-12 і IL-23 (фігура 1.1). Є деякі дані про метод, за допомогою якого антитіла першого класу інгібують комплекс “рецептор IL-12/23 – ліганд”, а тому ці антитіла мають антагоністичну дію. Giles-Komar і співробітниками (WO 2006/069036) було описано анти-IL-12p40 антитіло, яке є специфічним до амінокислотних залишків 1-88 у IL-12p40. Це антитіло також характеризується як антитіло, що специфічно інгібує взаємодію IL-12 і IL-23 з IL-12Rβ1 (Papp et al. 2008 Lancet 371, 1675-84). Аналогічним чином, у літературі було описано й інше антитіло, що інгібує взаємодію IL-12/23 з IL-12Rβ1 (Ding et al. 2008 Curr. Opin. Investig. Drugs 9, 515-22). У даному винаході описані антитіла, що інгібують комплекс “рецептор IL-12/23 – ліганд” завдяки новому механізму дії (фігура 2.3). Цей новий механізм дії полягає в селективній нейтралізації взаємодії IL-12/IL12Rβ2 і взаємодії IL-23/IL-23R. Ці антитіла відрізняються від описаних раніше антитіл (див. вище) тим, що вони не мають здатності нейтралізувати зв’язування IL-12/23 з IL-12Rβ1. Ці нові антитіла також відрізняються тим, що вони не мають здатності інгібувати зв’язування IL12p40/p80 з IL-12Rβ1, і таким чином, не знижують роль, яку відіграє IL-12p40/80 у захисті хазяїна, а тому можуть мати поліпшений профіль безпеки в порівнянні з іншими анти-IL-12/23 антитілами. Такі антитіла з новими механізмами дії можуть забезпечувати більш ефективне 3 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 лікування захворювань, асоційованих із IL-12/23, але є більш безпечними. Крім того, такі антитіла можуть мати підвищену ефективність, оскільки вони не інгібують дію природних антагоністів IL-12 і IL-23, IL-12p40 або IL-12p80. Це дозволяє використовувати ці антитіла і IL12p40 або IL-12p80 у ролі антагоністів, і тим самим підвищувати рівень інгібування в порівнянні з рівнем інгібування, що спостерігається при введенні тільки одного антитіла. Опис суті винаходу Даний винахід стосується антитіла, що містить антигензв’язувальний домен, який зв’язується з людським IL-12 і людським IL-23, де зазначене антитіло зв’язується з людським IL12p40, що присутній у вигляді мономера (людським IL-12p40) і у вигляді гомодимера (людським IL-12p80), і де зазначене антитіло інгібує зв’язування людського IL-12 із людським IL-12Rβ2 і зв’язування людського IL-23 із людським IL-23R, але не інгібує зв’язування людського IL-12, або людського IL-23, або людського IL-12p40, або людського IL-12p80 із людським IL-12Rβ1. Даний винахід також стосується способу лікування або ослаблення симптомів принаймні одного захворювання, асоційованого з IL-12 і/або IL-23, у клітинах, тканинах, органах, в організмі тварини або пацієнта, де зазначений спосіб включає застосування антитіла відповідно до винаходу або його специфічної частини або специфічного варіанта. Антитіло відповідно до винаходу може бути також використане для детектування або визначення присутності IL-12, IL-23, IL-12p40 або IL-12p80 у зразку. Цей спосіб включає введення зазначеного антитіла в зразок і визначення рівня зв’язування зазначеного антитіла з IL-12, IL-23, IL-12p40 або IL-12p80, що є присутніми у зразку. Для кращого розуміння суті даного винаходу нижче описані різні форми його здійснення з посиланнями на графічний матеріал і приклади. Стислий опис графічного матеріалу Фігура 1: Різні класи анти-IL-12/23 антитіл. Фігура 1.1: антитіло, яке зв’язується із субодиницею p40 у IL-12, IL-23, IL-12p40 і IL-12p80; Фігура 1.2: антитіло, яке зв’язується із субодиницею p35 у IL-12; Фігура 1.3: антитіло, яке зв’язується із субодиницями p35 і p40 у IL-12, що є присутніми у вигляді гетеродимеру; Фігура 1.4: антитіло, яке зв’язується із субодиницею р19 у IL-23; Фігура 1.5: антитіло, яке зв’язується із субодиницею p40, що є присутньою у IL-23, IL-12p40 і IL-12p80, але не в IL-12. Фігура 2: Взаємодії рецепторів IL-12/23. IL-12 зв’язується з IL-12Rβ1 і з IL-12Rβ2, IL-23 зв’язується з IL-12Rβ1 і з IL-23R. IL-12p40 зв’язується з IL-12Rβ1. IL-12p80 зв’язується з IL12Rβ1. Фігура 2.1: Субодиниці IL-12 і IL-23. Фігура 2.2: Антитіло, яке інгібує зв’язування IL-12 з IL-12Rβ2. Фігура 2.3: Антитіло, яке інгібує зв’язування IL-12 з IL-12Rβ2 і зв’язування IL-23 з IL23R. Фігура 3: PMA204 і антитіло 1 зв’язуються з IL-12 (A), IL-23 (B), IL-12p40 (C) і IL-12p80 (D) залежно від дози, як було виміряно за допомогою ELISA. Фігура 4: PMA204 і антитіло 1 нейтралізують зв’язування IL-12 з IL-12Rβ2 (A) і IL-23 з IL-23R (B). Фігура 5: PMA204 і антитіло 1 не інгібують зв’язування IL-12 з IL-12Rβ1 (A) і IL-12p80 з IL12Rβ1 (B). Фігура 6: PMA204 і антитіло 1 не інгібують зв’язування IL-12p40 з IL-12Rβ1 (A) і IL-23 з IL12Rβ1 (B). Фігура 7: Антитіло 1 не інгібує зв’язування IL-12p40 (A), IL-12 (B), IL-23 (C) із клітинною лінією Jurkat, стабільно трансфікованою IL-12Rβ1. Антитіло 202.1, що використовують як позитивний контроль, інгібує зв’язування IL-12p40, IL-12 і IL-23 з цією клітинною лінією залежно від дози. Фігура 8: Антитіло 1 зв’язується з IL-12p40 (A), IL-12 (B) і IL-23 (C), зв’язаними з клітинними лініями Jurkat, стабільно трансфікованими IL-12Rβ1, і утворює комплекс. Антитіло 202.1, що використовують як позитивний контроль, не має здатність утворювати такий комплекс. Фігура 9: Дані ELISA, що вказують на зв’язування різних антитіл з IL-12 і IL-23. Фігура 10: Електрофорез у ДСН-ПААГ, проведений для антитіл 1, 3, 4, 7 і порівняльного антитіла, продемонстрував різні патерни смуг. Фігура 11: PMA204, антитіло 1, антитіло 50, антитіло 68 і антитіло 80 продемонстрували інгібування IL-12-індукованого вивільнення IFN-γ клітинами NK-92. Фігура 12: Дані ELISA, що вказують на зв’язування різних антитіл з IL-12 і IL-23. Фігура 13: Дані ELISA, що вказують на зв’язування різних антитіл з IL-12 і IL-23. Фігура 14: Антитіло 80 і антитіло 136 інгібували IL-23-індуковану секрецію IL-17 мишачими спленоцитами. Фігура 15: Дані ELISA, що вказують на зв’язування різних антитіл з IL-12 і IL-23. Фігура 16: Дані ELISA, що вказують на зв’язування різних антитіл з IL-12 і IL-23. Фігура 17: Антитіло 80 і антитіло 136 інгібували IL-12-індуковане вивільнення IFN-γ 4 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 людськими МКПК. Фігура 18: Дані ELISA, що вказують на зв’язування різних антитіл з IL-12 і IL-23. Фігура 19: Дані ELISA, що вказують на зв’язування різних антитіл з IL-12 і IL-23. Фігура 20: Дані ELISA, що вказують на зв’язування різних антитіл з IL-12 і IL-23. Фігура 21: Експерименти з конкурентного зв’язування, проведені методом поверхневого плазмонного резонансу (ППР), показали, що антитіло 136 і PMA204 конкурують за зв’язування з IL-12 (A) і IL-23 (B). Фігура 22: Експерименти з конкурентного зв’язування, проведені за допомогою ППР, показали, що антитіло 136 і PMA202 не конкурують за зв’язування з IL-12 (A) і IL-23 (B). Фігура 23: Експерименти з конкурентного зв’язування, проведені за допомогою ELISA, показали, що PMA204 і антитіло 202.1 не конкурують за зв’язування з IL-12 або IL-23. PMA204 і антитіло 136 конкурують за зв’язування з IL-12 і IL-23. Фігура 24: Антитіло 80 і антитіло 136, на відміну від антитіла 202.1, нейтралізують зв’язування IL-12 з IL-12Rβ2 (A) і IL-23 з IL-23R (B), що вказує на відсутність інгібування при найвищих концентраціях тестованого антитіла. Фігура 25: PMA204 і антитіло 1 не мають здатності нейтралізувати зв’язування IL-12 з IL12Rβ1 (A) і IL-23 з IL-12Rβ1 (B). Антитіло 202.1 виявляє дозозалежне інгібування зв’язування IL12 з IL-12Rβ1 (A) і зв’язування IL-23 з IL-12Rβ1 (B). Фігура 26: Різні гуманізовані та афінно зрілі антитіла інгібують IL-23-індуковане вивільнення IL-17 із мишачих спленоцитів. Показано дві групи афінно зрілих гуманізованих “перших” антитіл, одержаних на основі антитіла 80 (A) і на основі антитіла 136 (B). Фігура 27: Через 6 днів після внутрішньошкірного введення IL-23 мишам, у цих мишей починалося шкірне запалення, що нагадує псоріаз. A) Введення контрольного ізотипу не сприяло попередженню шкірного запалення, однак, антитіло 80 і антитіло 136 сприяли зниженню запалення в цієї моделі, на що вказувала нижня клінічна оцінка. B) На гістологічному рівні, через 6 днів після внутрішньошкірного введення IL-23 спостерігалося потовщення епідермісу. Обробка антитілом 80 і антитілом 136 призводила до зменшення товщини епідермісу, а обробка антитілом контрольного ізотипу не давала якого-небудь ефекту. Фігура 28: Різні гуманізовані та афінно зрілі антитіла інгібували вивільнення IFN-γ, індуковане химерним IL-12, із мишачих спленоцитів. Показано дві групи афінно зрілих гуманізованих “перших” антитіл, одержаних на основі антитіла 80 (A) і на основі антитіла 136 (B). Фігура 29: У мишей, яким вводили повторні ін’єкції химерного IL-12, спостерігалися підвищені рівні IFN-γ у сироватці. При обробці антитілом 80 або антитілом 136, рівні IFN-γ у сироватці знижувалися, на відміну від обробки антитілом контрольного ізотипу. Фігура 30: (A) Антитіло 80 має здатність розпізнавати рекомбінантний IL-23 у “сендвіч”ELISA. (B) Антитіло 80 має здатність розпізнавати нативний IL-23, продукований SACсимульованими МКПК у “сендвіч”-ELISA. Фігура 31: Антитіло 80 у значній мірі зв’язується з білком IL-23WT (дикого типу), але в меншому ступені зв’язується з мутантами IL-23, D265A і R266A, в аналізі ELISA. Детальний опис винаходу Авторами даного винаходу була одержана панель антитіл проти IL-12. При скринінгу цих антитіл було зненацька виявлено, що конкретна субсерія антитіл зв’язується з людським IL-12 і IL-23 та інгібує зв’язування IL-12 з IL-12Rβ2 і IL-23 з IL-23R, не інгібує зв’язування IL-12 або IL-23 або IL-12p40 або IL-12p80 з IL-12Rβ1. Тому, активність IL-12 і IL-23 може бути модифікована методом, який не міг бути здійснений раніше. Відповідно до цього, даний винахід стосується антитіла, що містить антигензв’язувальний домен, який зв’язується з людським IL-12 і людським IL-23, де зазначене антитіло зв’язується з людським IL-12p40, що є присутнім у вигляді мономера (людським IL-12p40) і у вигляді гомодимера (людським IL-12p80), і де зазначене антитіло інгібує зв’язування людського IL-12 із людським IL-12Rβ2 і зв’язування людського IL-23 із людським IL-23R, але не інгібує зв’язування людського IL-12 або людського IL-23, або людського IL-12p40 або людського IL-12p80 з людським IL-12Rβ1. У переважному варіанті винаходу, антитіло конкурує за зв’язування з людським IL-12 і/або з людським IL-23, де зазначене антитіло містить варіабельну ділянку важкого ланцюга, що має послідовність РМА204 (SEQ ID NO: 6) і/або варіабельну ділянку легкого ланцюга, що має послідовність PMA204 (SEQ ID NO: 7). Використовуваний тут термін “конкурує” означає, що тестоване антитіло, при його використанні в такій же концентрації, як і PMA204, знижує рівень зв’язування PMA204 з IL-12, IL23 або IL-12p40 принаймні на 10 %, як було визначено за допомогою ELISA. 5 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 Даний винахід стосується антитіла або його варіанта, які зв’язуються з IL-12p40, що є присутнім у IL-12 і IL-23, що мають послідовність, представлену в SEQ ID NО: 1 і проілюстровану нижче: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAG QYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTF SVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKY ENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDR VFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS У переважному варіанті винаходу, епітоп, зв’язаний з антитілом, знаходиться в послідовності VQVQGKSKREKKDRVFTDKTSATVICRKNASISV (SEQ ID NO: 65). Зокрема, зазначене антитіло зв’язується з людським IL-12p40 (SEQ ID NO: 1) у положенні Asp 265. В іншому своєму аспекті, даний винахід стосується антитіла, що містить антигензв’язувальний домен, який зв’язується з людським IL-23 (SEQ ID NO: 66), де рівень зв’язування зазначеного антитіла з людським IL-23 (SEQ ID NO: 66) перевищує рівень зв’язування зазначеного антитіла з мутантним IL-23 D265A (SEQ ID NO: 75). Зазначене антитіло може також зв’язуватися з людським IL-12p40, що є присутнім у вигляді мономера (людським IL-12p40) і у вигляді гомодимера (людським IL-12p80), та інгібує зв’язування людського IL-12 із людським IL-12Rβ2 і людського IL-23 із людським IL-23R, але не інгібує зв’язування людського IL-12 або людського IL-23 або людського IL-12p40 або людського IL-12p80 із людським IL-12Rβ1. Даний винахід стосується антитіл, які можуть бути використані для лікування принаймні одного стану, асоційованого з IL-12 і/або IL-23, шляхом селективної нейтралізації зв’язування IL12 з IL-12Rβ2 і зв’язування IL-23 з IL-23R. Даний винахід стосується антитіла, що містить 3 послідовності CDR важкого ланцюга, вибрані з: CDRHC1: DYYX1H, де: X1=M або L; CDRHC2: WIDPENGDTEX2APKFQG, де: X2=Y, H або S; CDRHC3: X3KELRYFDV, де: X3=C, A, N, D, E, Q, G, H, I, L, P або V. Даний винахід стосується антитіла, що містить 3 послідовності CDR легкого ланцюга, вибрані з: CDR1C1: RAX4X5SISINLH, де: X4=S або P; X5=Q або R; CDR1C2: FAX6QSX7S, де: X6=S або R; X7=I або T; CDR1C3: QQSNSX8PLT, де: X8=W або F Даний винахід стосується антитіла, що містить 3 послідовності CDR важкого ланцюга, вибрані з: CDRHCl: DYYX1H, де: X1=M або L; CDRHC2: WIDPENGDTEX2APKFQG, де: X2=Y, H або S; CDRHC3: X3KELRYFDV, де: X3=C, A, N, D, E, Q, G, H, I, L, P або V. і 3 послідовності CDR легкого ланцюга, вибрані з: CDR1C1: RAX4X5SISINLH, де: X4=S або P; X5=Q або R; CDR1C2: FAX6QSX7S, де: X6=S або R; X7=I або T; CDR1C3: QQSNSX8PLT, де: X8=W або F. Даний винахід стосується антитіла, що складається з варіабельної ділянки важкого ланцюга імуноглобуліну, що складається з однієї з нижченаведених послідовностей: 6 UA 104297 C2 5 10 15 20 25 30 35 40 SEQ ID NO: 6, SEQ ID NO: 62, SEQ ID NO: 114, SEQ ID NO: 142, SEQ ID NO: 28, SEQ ID NO: 87, SEQ ID NO: 115, SEQ ID NO: 143, SEQ ID NO: 29, SEQ ID NO: 88, SEQ ID NO: 116, SEQ ID NO: 144, SEQ ID NO: 30, SEQ ID NO: 90, SEQ ID NO: 117, SEQ ID NO: 145, SEQ ID NO: 31, SEQ ID NO: 91, SEQ ID NO: 118, SEQ ID NO: 146, SEQ ID NO: 33, SEQ ID NO: 92, SEQ ID NO: 119, SEQ ID NO: 147, SEQ ID NO: 34, SEQ ID NO: 93, SEQ ID NO: 120, SEQ ID NO: 148, SEQ ID NO: 35, SEQ ID NO: 94, SEQ ID NO: 122, SEQ ID NO: 149, SEQ ID NO: 36, SEQ ID NO: 95, SEQ ID NO: 124, SEQ ID NO: 150, SEQ ID NO: 38, SEQ ID NO: 96, SEQ ID NO: 125, SEQ ID NO: 151, SEQ ID NO: 39, SEQ ID NO: 97, SEQ ID NO: 126, SEQ ID NO: 152, SEQ ID NO: 40, SEQ ID NO: 99, SEQ ID NO: 127, SEQ ID NO: 153, SEQ ID NO: 41, SEQ ID NO: 100, SEQ ID NO: 128, SEQ ID NO: 154, SEQ ID NO: 42, SEQ ID NO: 101, SEQ ID NO: 129, SEQ ID NO: 155, SEQ ID NO: 43, SEQ ID NO: 102, SEQ ID NO: 130, SEQ ID NO: 156, SEQ ID NO: 44, SEQ ID NO: 103, SEQ ID NO: 131, SEQ ID NO: 157, SEQ ID NO: 45, SEQ ID NO: 104, SEQ ID NO: 132, SEQ ID NO: 158, SEQ ID NO: 53, SEQ ID NO: 105, SEQ ID NO: 133, SEQ ID NO: 159, SEQ ID NO: 54, SEQ ID NO: 106, SEQ ID NO: 134, SEQ ID NO: 160, SEQ ID NO: 55, SEQ ID NO: 107, SEQ ID NO: 135, SEQ ID NO: 161, SEQ ID NO: 56, SEQ ID NO: 108, SEQ ID NO: 136, SEQ ID NO: 162, SEQ ID NO: 57, SEQ ID NO: 109, SEQ ID NO: 137, SEQ ID NO: 163, SEQ ID NO: 58, SEQ ID NO: 110, SEQ ID NO: 138, SEQ ID NO: 164, SEQ ID NO: 59, SEQ ID NO: 111, SEQ ID NO: 139, SEQ ID NO: 165, SEQ ID NO: 60, SEQ ID NO: 112, SEQ ID NO: 140, SEQ ID NO: 166, SEQ ID NO: 61, SEQ ID NO: 113, SEQ ID NO: 141 і SEQ ID NO: 167. Даний винахід стосується антитіла, що складається з варіабельної ділянки легкого ланцюга імуноглобуліну, що складається з однієї з нижченаведених послідовностей: SEQ ID NO: 7, SEQ ID NO: 169, SEQ ID NO: 181, SEQ ID NO: 193, SEQ ID NO: 32, SEQ ID NO: 170, SEQ ID NO: 182, SEQ ID NO: 194, SEQ ID NO: 37, SEQ ID NO: 171, SEQ ID NO: 183, SEQ ID NO: 195, SEQ ID NO: 42, SEQ ID NO: 172, SEQ ID NO: 184, SEQ ID NO: 196, SEQ ID NO: 46, SEQ ID NO: 173, SEQ ID NO: 185, SEQ ID NO: 197, SEQ ID NO: 47, SEQ ID NO: 174, SEQ ID NO: 186, SEQ ID NO: 198, SEQ ID NO: 48, SEQ ID NO: 175, SEQ ID NO: 187, SEQ ID NO: 199, SEQ ID NO: 49, SEQ ID NO: 176, SEQ ID NO: 188, SEQ ID NO: 200, SEQ ID NO: 50, SEQ ID NO: 177, SEQ ID NO: 189, SEQ ID NO: 201, SEQ ID NO: 51, SEQ ID NO: 178, SEQ ID NO: 190, SEQ ID NO: 52, SEQ ID NO: 179 і SEQ ID NO: 192. Даний винахід стосується антитіла, яке також включає акцепторну каркасну ділянку важкого ланцюга людського імуноглобуліну. А зокрема, даний винахід стосується антитіла, в якому зазначена акцепторна каркасна ділянка містить амінокислотну послідовність, вибрану з групи, що складається з SEQ ID NO: 202, SEQ ID NO: 205, SEQ ID NO: 208, SEQ ID NO: 203, SEQ ID NO: 206, SEQ ID NO: 209, SEQ ID NO: 204 і SEQ ID NO: 207. Даний винахід стосується антитіла, яке також включає акцепторну каркасну ділянку легкого ланцюга людського імуноглобуліну. А зокрема, даний винахід стосується антитіла, в якому зазначена акцепторна каркасна ділянка містить амінокислотну послідовність, вибрану з групи, що складається з SEQ ID NO: 210, SEQ ID NO: 213, SEQ ID NO: 216, SEQ ID NO: 211, SEQ ID NO: 214, SEQ ID NO: 212 і SEQ ID NO: 215. Даний винахід стосується антитіла, що містить дві варіабельні ділянки імуноглобуліну, де зазначені дві варіабельні ділянки імуноглобуліну вибрані з групи, що складається з: SEQ ID NO: 6 і SEQ ID NO: 7 SEQ ID NO: 115 і SEQ ID NO: 190 SEQ ID NO: 6 і SEQ ID NO: 169 SEQ ID NO: 115 і SEQ ID NO: 192 SEQ ID NO: 28 і SEQ ID NO: 179 SEQ ID NO: 115 і SEQ ID NO: 193 SEQ ID NO: 29 і SEQ ID NO: 179 SEQ ID NO: 115 і SEQ ID NO: 194 SEQ ID NO: 30 і SEQ ID NO: 179 SEQ ID NO: 115 і SEQ ID NO: 195 SEQ ID NO: 31 і SEQ ID NO: 32 SEQ ID NO: 115 і SEQ ID NO: 196 SEQ ID NO: 33 і SEQ ID NO: 179 SEQ ID NO: 115 і SEQ ID NO: 197 SEQ ID NO: 34 і SEQ ID NO: 51 SEQ ID NO: 115 і SEQ ID NO: 198 SEQ ID NO: 34 і SEQ ID NO: 47 SEQ ID NO: 115 і SEQ ID NO: 199 SEQ ID NO: 35 і SEQ ID NO: 179 SEQ ID NO: 115 і SEQ ID NO: 200 SEQ ID NO: 36 і SEQ ID NO: 37 SEQ ID NO: 115 і SEQ ID NO: 201 SEQ ID NO: 38 і SEQ ID NO: 179 SEQ ID NO: 116 і SEQ ID NO: 173 SEQ ID NO: 38 і SEQ ID NO: 51 SEQ ID NO: 116 і SEQ ID NO: 174 SEQ ID NO: 38 і SEQ ID NO: 32 SEQ ID NO: 116 і SEQ ID NO: 175 SEQ ID NO: 38 і SEQ ID NO: 47 SEQ ID NO: 116 і SEQ ID NO: 176 SEQ ID NO: 38 і SEQ ID NO: 52 SEQ ID NO: 116 і SEQ ID NO: 177 SEQ ID NO: 39 і SEQ ID NO: 179 SEQ ID NO: 117 і SEQ ID NO: 173 SEQ ID NO: 40 і SEQ ID NO: 179 SEQ ID NO: 117 і SEQ ID NO: 174 SEQ ID NO: 41 і SEQ ID NO: 42 SEQ ID NO: 117 і SEQ ID NO: 175 7 UA 104297 C2 SEQ ID NO: 43 SEQ ID NO: 44 SEQ ID NO: 44 SEQ ID NO: 44 SEQ ID NO: 44 SEQ ID NO: 44 SEQ ID NO: 45 SEQ ID NO: 45 SEQ ID NO: 53 SEQ ID NO: 54 SEQ ID NO: 55 SEQ ID NO: 56 SEQ ID NO: 57 SEQ ID NO: 58 SEQ ID NO: 59 SEQ ID NO: 60 SEQ ID NO: 61 SEQ ID NO: 62 SEQ ID NO: 87 SEQ ID NO: 88 SEQ ID NO: 90 SEQ ID NO: 91 SEQ ID NO: 92 SEQ ID NO: 93 SEQ ID NO: 94 SEQ ID NO: 95 SEQ ID NO: 96 SEQ ID NO: 97 SEQ ID NO: 99 SEQ ID NO: 100 SEQ ID NO: 101 SEQ ID NO: 102 SEQ ID NO: 103 SEQ ID NO: 104 SEQ ID NO: 105 SEQ ID NO: 106 SEQ ID NO: 106 SEQ ID NO: 107 SEQ ID NO: 107 SEQ ID NO: 108 SEQ ID NO: 108 SEQ ID NO: 109 SEQ ID NO: 110 SEQ ID NO: 111 SEQ ID NO: 112 SEQ ID NO: 113 SEQ ID NO: 113 SEQ ID NO: 113 SEQ ID NO: 113 SEQ ID NO: 113 SEQ ID NO: 113 SEQ ID NO: 114 SEQ ID NO: 114 SEQ ID NO: 114 SEQ ID NO: 114 SEQ ID NO: 114 SEQ ID NO: 115 SEQ ID NO: 115 SEQ ID NO: 115 SEQ ID NO: 115 і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і SEQ ID NO: 179 SEQ ID NO: 179 SEQ ID NO: 51 SEQ ID NO: 32 SEQ ID NO: 47 SEQ ID NO: 52 SEQ ID NO: 179 SEQ ID NO: 179 SEQ ID NO: 41 SEQ ID NO: 179 SEQ ID NO: 179 SEQ ID NO: 179 SEQ ID NO: 179 SEQ ID NO: 42 SEQ ID NO: 179 SEQ ID NO: 179 SEQ ID NO: 42 SEQ ID NO: 42 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 7 SEQ ID NO: 171 SEQ ID NO: 172 SEQ ID NO: 171 SEQ ID NO: 172 SEQ ID NO: 171 SEQ ID NO: 172 SEQ ID NO: 170 SEQ ID NO: 171 SEQ ID NO: 172 SEQ ID NO: 169 SEQ ID NO: 173 SEQ ID NO: 174 SEQ ID NO: 175 SEQ ID NO: 176 SEQ ID NO: 177 SEQ ID NO: 176 SEQ ID NO: 173 SEQ ID NO: 174 SEQ ID NO: 175 SEQ ID NO: 176 SEQ ID NO: 177 SEQ ID NO: 173 SEQ ID NO: 174 SEQ ID NO: 175 SEQ ID NO: 176 SEQ ID NO: 117 SEQ ID NO: 117 SEQ ID NO: 118 SEQ ID NO: 118 SEQ ID NO: 119 SEQ ID NO: 119 SEQ ID NO: 119 SEQ ID NO: 119 SEQ ID NO: 119 SEQ ID NO: 119 SEQ ID NO: 119 SEQ ID NO: 119 SEQ ID NO: 119 SEQ ID NO: 119 SEQ ID NO: 119 SEQ ID NO: 120 SEQ ID NO: 120 SEQ ID NO: 122 SEQ ID NO: 124 SEQ ID NO: 125 SEQ ID NO: 126 SEQ ID NO: 127 SEQ ID NO: 128 SEQ ID NO: 129 SEQ ID NO: 130 SEQ ID NO: 131 SEQ ID NO: 132 SEQ ID NO: 133 SEQ ID NO: 134 SEQ ID NO: 135 SEQ ID NO: 136 SEQ ID NO: 137 SEQ ID NO: 138 SEQ ID NO: 139 SEQ ID NO: 140 SEQ ID NO: 141 SEQ ID NO: 142 SEQ ID NO: 143 SEQ ID NO: 144 SEQ ID NO: 145 SEQ ID NO: 146 SEQ ID NO: 147 SEQ ID NO: 148 SEQ ID NO: 149 SEQ ID NO: 150 SEQ ID NO: 151 SEQ ID NO: 152 SEQ ID NO: 153 SEQ ID NO: 154 SEQ ID NO: 155 SEQ ID NO: 156 SEQ ID NO: 157 SEQ ID NO: 158 SEQ ID NO: 159 SEQ ID NO: 160 SEQ ID NO: 161 SEQ ID NO: 161 SEQ ID NO: 162 SEQ ID NO: 162 SEQ ID NO: 163 8 і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і і SEQ ID NO: 176 SEQ ID NO: 177 SEQ ID NO: 178 SEQ ID NO: 179 SEQ ID NO: 178 SEQ ID NO: 179 SEQ ID NO: 51 SEQ ID NO: 189 SEQ ID NO: 46 SEQ ID NO: 47 SEQ ID NO: 48 SEQ ID NO: 49 SEQ ID NO: 50 SEQ ID NO: 51 SEQ ID NO: 52 SEQ ID NO: 178 SEQ ID NO: 179 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 176 SEQ ID NO: 189 SEQ ID NO: 189 SEQ ID NO: 189 SEQ ID NO: 189 SEQ ID NO: 189 SEQ ID NO: 189 SEQ ID NO: 189 SEQ ID NO: 189 SEQ ID NO: 189 SEQ ID NO: 179 SEQ ID NO: 189 SEQ ID NO: 179 SEQ ID NO: 189 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 SEQ ID NO: 115 і SEQ ID NO: 177 SEQ ID NO: 163 і SEQ ID NO: 179 SEQ ID NO: 115 і SEQ ID NO: 181 SEQ ID NO: 164 і SEQ ID NO: 189 SEQ ID NO: 115 і SEQ ID NO: 182 SEQ ID NO: 164 і SEQ ID NO: 179 SEQ ID NO: 115 і SEQ ID NO: 183 SEQ ID NO: 165 і SEQ ID NO: 189 SEQ ID NO: 115 і SEQ ID NO: 184 SEQ ID NO: 165 і SEQ ID NO: 179 SEQ ID NO: 115 і SEQ ID NO: 185 SEQ ID NO: 166 і SEQ ID NO: 189 SEQ ID NO: 115 і SEQ ID NO: 186 SEQ ID NO: 166 і SEQ ID NO: 179 SEQ ID NO: 115 і SEQ ID NO: 187 SEQ ID NO: 167 і SEQ ID NO: 189 SEQ ID NO: 115 і SEQ ID NO: 188 SEQ ID NO: 167 і SEQ ID NO: 179 SEQ ID NO: 115 і SEQ ID NO: 189 SEQ ID NO: 168 і SEQ ID NO: 189. Даний винахід стосується антитіла, в якому зазначена акцепторна людська каркасна ділянка містить принаймні одну амінокислотну заміну в каркасній ділянці в положенні ключового залишку, де зазначений ключовий залишок вибраний із групи, що складається з залишку, суміжного з CDR; залишку сайта глікозилювання; рідкого залишку; залишку, здатного взаємодіяти із субодиницею p40 людського IL-12; залишку, здатного взаємодіяти з CDR; канонічного залишку; контактного залишку, розташованого між варіабельною ділянкою важкого ланцюга і варіабельною ділянкою легкого ланцюга; залишку, що знаходиться в зоні Верньєра; і залишку, що знаходиться в ділянці, яка перекривається в ділянці, розташованій між CDR1 VHдомену, визначеного за Чотієм, і першою каркасною ділянкою важкого ланцюга, визначеною за Кебатом. В іншому аспекті винаходу, зазначена людська акцепторна каркасна ділянка містить принаймні одну амінокислотну заміну в каркасній ділянці, де зазначена амінокислотна послідовність каркасної ділянки принаймні на 65 % ідентична послідовності зазначеної людської акцепторної каркасної ділянки і містить принаймні 70 амінокислотних залишків, ідентичних амінокислотним залишкам зазначеної людської акцепторної каркасної ділянки. Даний винахід стосується антитіла, що являє собою консенсусний домен людської VH. Крім того, даний винахід стосується антитіла, що являє собою консенсусний домен людської VL. Даний винахід стосується антитіла, де зазначена людська акцепторна каркасна ділянка містить принаймні одну амінокислотну заміну в каркасній ділянці, де зазначена амінокислотна послідовність каркасної ділянки принаймні на 65 % ідентична послідовності зазначеної людської акцепторної каркасної ділянки і містить принаймні 70 амінокислотних залишків, ідентичних амінокислотним залишкам зазначеної людської акцепторної каркасної ділянки. У даному винаході описане антитіло, що містить константну ділянку важкого ланцюга імуноглобуліну людини або приматів, що не є людиною, де зазначене антитіло вибране з групи, що складається з Ig1, Ig2, Ig3, Ig4, IgM, IgE і IgA. У даному винаході описане антитіло, яке містить константну ділянку легкого ланцюга імуноглобуліну людини або приматів, що не є людиною, де зазначене антитіло вибране з групи, що складається з ланцюгів каппа або лямбда. Даний винахід також стосується способу продукування антитіла відповідно до винаходу, де зазначений спосіб включає: (і) імунізацію тварини людським IL-12p40 або фрагментом людського IL-12p40 з одержанням першої панелі антитіл; (ii) відбір із цієї першої панелі антитіл, які зв’язуються з людським IL-12 і людським IL-23 з одержанням другої панелі антитіл; і (iii) відбір із цієї другої панелі антитіл, які зв’язуються із субодиницею p40, що є присутньою у вигляді мономера (людського IL-12p40) і у вигляді гомодимера (людського IL-12p80), і які інгібують зв’язування людського IL-12 із людським IL-12Rβ2 і зв’язування людського IL-23 із людським IL-23R, але не інгібують зв’язування людського IL-12 або людського IL-23, або людського IL-12p40 або людського IL-12p80 з людським IL-12Rβ1. Зазначений спосіб може також включати на стадії (ii) відбір антитіл, які також зв’язуються з пептидом, що має послідовність VQVQGKSKREKKDRVFTDKTSATVICRKNASISV (SEQ ID NO: 65). Даний винахід також стосується іншого способу продукування антитіла відповідно до винаходу, де зазначений спосіб включає: (і) імунізацію тварини пептидом, що має послідовність VQVQGKSKREKKDRVFTDKTSATVICRKNASISV (SEQ ID NO: 65), з одержанням першої панелі антитіл; (ii) відбір із цієї першої панелі антитіл, які зв’язуються з людським IL-12 і людським IL-23, з одержанням другої панелі антитіл; і (iii) відбір із цієї другої панелі антитіл, які зв’язуються із субодиницею p40, що є присутньою у вигляді мономера (людського IL-12p40) і у вигляді гомодимера (людського IL-12p80), і які 9 UA 104297 C2 5 10 15 20 інгібують зв’язування людського IL-12 з людським IL-12Rβ2 і зв’язування людського IL-23 із людським IL-23R, але не інгібують зв’язування людського IL-12 або людського IL-23, або людського IL-12p40 або людського IL-12p80 з людським IL-12Rβ1. Даний винахід також стосується способу продукування антитіла відповідно до винаходу, де зазначений спосіб включає: (і) одержання бібліотеки представлення людських антитіл і створення першої панелі антитіл; (ii) відбір із цієї першої панелі антитіл, які зв’язуються з людським IL-12 і людським IL-23 з одержанням другої панелі антитіл; і (iii) відбір із цієї другої панелі антитіл, які зв’язуються із субодиницею p40, що є присутньою у вигляді мономера (людського IL-12p40) і/або у вигляді гомодимера (людського IL-12p80), і які інгібують зв’язування людського IL-12 з людським IL-12Rβ2 і зв’язування людського IL-23 з людським IL-23R, але не інгібують зв’язування людського IL-12 або людського IL-23, або людського IL-12p40 або людського IL-12p80 з людським IL-12Rβ1. Даний винахід стосується молекули нуклеїнової кислоти, що кодує домен VH відповідно до винаходу. При цьому, переважно, щоб зазначена молекула нуклеїнової кислоти мала послідовність, вибрану з: SEQ ID NO: 217 SEQ ID NO: 254 SEQ ID NO: 282 SEQ ID NO: 310 SEQ ID NO: 218 SEQ ID NO: 255 SEQ ID NO: 283 SEQ ID NO: 311 SEQ ID NO: 219 SEQ ID NO: 257 SEQ ID NO: 284 SEQ ID NO: 312 SEQ ID NO: 220 SEQ ID NO: 258 SEQ ID NO: 285 SEQ ID NO: 313 SEQ ID NO: 222 SEQ ID NO: 259 SEQ ID NO: 286 SEQ ID NO: 314 SEQ ID NO: 223 SEQ ID NO: 260 SEQ ID NO: 287 SEQ ID NO: 315 SEQ ID NO: 224 SEQ ID NO: 261 SEQ ID NO: 289 SEQ ID NO: 316 SEQ ID NO: 225 SEQ ID NO: 262 SEQ ID NO: 291 SEQ ID NO: 317 SEQ ID NO: 227 SEQ ID NO: 263 SEQ ID NO: 292 SEQ ID NO: 318 SEQ ID NO: 228 SEQ ID NO: 264 SEQ ID NO: 293 SEQ ID NO: 319 SEQ ID NO: 229 SEQ ID NO: 266 SEQ ID NO: 294 SEQ ID NO: 320 SEQ ID NO: 230 SEQ ID NO: 267 SEQ ID NO: 295 SEQ ID NO: 321 SEQ ID NO: 232 SEQ ID NO: 268 SEQ ID NO: 296 SEQ ID NO: 322 SEQ ID NO: 233 SEQ ID NO: 269 SEQ ID NO: 297 SEQ ID NO: 323 SEQ ID NO: 234 SEQ ID NO: 270 SEQ ID NO: 298 SEQ ID NO: 324 SEQ ID NO: 242 SEQ ID NO: 271 SEQ ID NO: 299 SEQ ID NO: 325 SEQ ID NO: 243 SEQ ID NO: 272 SEQ ID NO: 300 SEQ ID NO: 326 SEQ ID NO: 244 SEQ ID NO: 273 SEQ ID NO: 301 SEQ ID NO: 327 SEQ ID NO: 245 SEQ ID NO: 274 SEQ ID NO: 302 SEQ ID NO: 328 SEQ ID NO: 246 SEQ ID NO: 275 SEQ ID NO: 303 SEQ ID NO: 329 SEQ ID NO: 247 SEQ ID NO: 276 SEQ ID NO: 304 SEQ ID NO: 330 SEQ ID NO: 248 SEQ ID NO: 277 SEQ ID NO: 305 SEQ ID NO: 331 SEQ ID NO: 249 SEQ ID NO: 278 SEQ ID NO: 306 SEQ ID NO: 332 SEQ ID NO: 250 SEQ ID NO: 279 SEQ ID NO: 307 SEQ ID NO: 333 SEQ ID NO: 251 SEQ ID NO: 280 SEQ ID NO: 308 SEQ ID NO: 334 SEQ ID NO: 252 SEQ ID NO: 281 SEQ ID NO: 309 SEQ ID NO: 335. Даний винахід стосується молекули нуклеїнової кислоти, що кодує домен VL відповідно до винаходу. При цьому, переважно, щоб зазначена молекула нуклеїнової кислоти мала послідовність, вибрану з: SEQ ID NO: 221 SEQ ID NO: 338 SEQ ID NO: 350 SEQ ID NO: 362 SEQ ID NO: 226 SEQ ID NO: 339 SEQ ID NO: 351 SEQ ID NO: 363 SEQ ID NO: 231 SEQ ID NO: 340 SEQ ID NO: 352 SEQ ID NO: 364 SEQ ID NO: 235 SEQ ID NO: 341 SEQ ID NO: 353 SEQ ID NO: 365 SEQ ID NO: 236 SEQ ID NO: 342 SEQ ID NO: 354 SEQ ID NO: 366 SEQ ID NO: 237 SEQ ID NO: 343 SEQ ID NO: 355 SEQ ID NO: 367 SEQ ID NO: 238 SEQ ID NO: 344 SEQ ID NO: 356 SEQ ID NO: 368 SEQ ID NO: 239 SEQ ID NO: 345 SEQ ID NO: 357 SEQ ID NO: 369 SEQ ID NO: 240 SEQ ID NO: 346 SEQ ID NO: 358 SEQ ID NO: 370 SEQ ID NO: 241 SEQ ID NO: 347 SEQ ID NO: 359 SEQ ID NO: 336 SEQ ID NO: 348 SEQ ID NO: 361. Даний винахід також стосується способу лікування захворювання в індивідуума, що включає введення зазначеному індивідууму антитіла відповідно до винаходу, де зазначене захворювання вибране з групи, що складається з ревматоїдного артриту, остеоартриту, реактивного артриту, псоріатичного артриту, втрати кісткової тканини, гіперчутливості 10 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 дихальних шляхів, хронічної обструктивної хвороби легенів, демієлінізуючого захворювання, псоріазу, розсіяного склерозу, гіперчутливості шкіри, гострого і хронічного відторгнення трансплантата, відторгнення алотрансплантата, реакції “трансплантат проти хазяїна”, системного склерозу, системного червоного вовчака, автоімунного запального захворювання кишечнику, запального захворювання сечостатевих шляхів, серцево-судинного захворювання, васкулітів, переміжної лихоманки, порушення метаболізму глюкози, хвороби легенів, раку, періодонтиту, гепатичного стромального кератиту, алергії, запального болю, спондилоартропатії, септицемії, септичного або ендотоксичного шоку, менінгіту, хірургічної травми, автоімунної хвороби крові, хвороби Альцгеймера, саркоїдозу, цирозу, гепатиту (включаючи автоімунний гепатит), первинного біліарного цирозу, увеїту, тиреоїдиту, атеросклерозу, алопеції, хвороби Вільсона, гломерулонефриту і дисліпідемії. Даний винахід також стосується принаймні одного антитіла, його специфічної частини або варіанту, використовуваним у способі або композиції шляхом їхнього введення в терапевтично ефективній кількості з метою модуляції, або лікування ослаблення симптомів принаймні одного захворювання, асоційованого з IL-12 і/або IL-23, у клітині, тканині, в органах і в організмі тварини або пацієнта, і/або, за необхідності, багатьох інших станів, де зазначене введення може бути здійснене до, після або під час лікування відомих і/або описаних, але не обмежуваних ними, тут, споріднених захворювань або станів. Даний винахід також стосується принаймні одного антитіла, його специфічної частини або варіанту, використовуваним у способі або композиції шляхом їхнього введення в терапевтично ефективній кількості з метою модуляції, або лікування ослаблення симптомів імунних, нервових і споріднених захворювань, таких як, але не обмежуваних ними, артрит, остеоартрит, ревматоїдний артрит, юнацький хронічний артрит, септичний артрит, артрит Лайма, псоріатичний артрит, реактивний артрит, спондилоартропатія, системний червоний вовчак, хвороба Крона, виразковий коліт, запальне захворювання кишечнику, інсулінозалежний цукровий діабет, тиреоїдит, астма, алергічні захворювання, псоріаз, склеродермальний дерматит, реакція “трансплантат проти хазяїна”, відторгнення трансплантованих органів, гостре або хронічне імунне захворювання, асоційоване з трансплантацією органів, саркоїдоз, атеросклероз, дисеміноване внутрішньосудинне згортання крові, хвороба Кавасакі, хвороба Грейвса, нефротичний синдром, синдром хронічної втоми, гранулематоз Вегенера, пурпура Геноха-Шенлейна, мікроскопічний васкуліт нирок, гострий і хронічний гепатит, увеїт, септичний шок, синдром токсичного шоку, септичний синдром, кахексія, інфекційні захворювання, захворювання, що викликані паразитами, синдром набутого імунодефіциту, гострий поперечний мієліт, хорея Гентингтона, хвороба Паркінсона, хвороба Альцгеймера, інсульт, первинний біліарний цироз, гемолітична анемія, злоякісні захворювання, серцева недостатність, інфаркт міокарда, хвороба Аддісона, спорадичний полігландулярний дефіцит типу І і полігландулярний дефіцит типу II, синдром Шмідта, (гострий) респіраторний дистрес-синдром дорослих, алопеція, вогнищева алопеція, серонегативна артропатія, артропатія, хвороба Рейтера, псоріатична артропатія, артропатія, асоційована з виразковим колітом, ентеропатичний синовіт, артропатія, асоційована із Сhlamydia, Yersinia і Salmonella, спондилоартропатія, атероматозне захворювання/артеріосклероз, атопічна алергія, автоімунне бульозне захворювання, вульгарна пухирчатка, листоподібна пухирчатка, пемфігоїд, хвороба прямих ланцюгів IgА, автоімунна гемолітична анемія, позитивна гемолітична анемія Кумбса, набута перніціозна анемія, юнацька перніціозна анемія, міалгічний енцефаліт/британський міалгічний енцефаломієліт, хронічний кандидоз шкіри і слизової оболонки, гігантоклітинний артеріїт, первинний склерозуючий гепатит, криптогенний автоімунний гепатит, синдром набутого імунодефіциту, захворювання, асоційовані з набутим імунодефіцитом, гепатит В, гепатит С, варіабельний некласифікований імунодефіцит (варіабельна некласифікована гіпогамаглобулінемія), застійна кардіоміопатія, безплідність у жінок, дисфункція яєчників, передчасна дисфункція яєчників, фіброзне захворювання легенів, криптогенний фіброзний альвеоліт, інтерстиціальна хвороба легенів після запалення, інтерстиціальний пневмоніт, інтерстиціальна хвороба легенів, асоційована з хворобою сполучної тканини, хвороба легенів, асоційована зі змішаним захворюванням сполучних тканин, інтерстиціальна хвороба легенів, асоційована із системним склерозом, інтерстиціальна хвороба легенів, асоційована з ревматоїдним артритом, хвороба легенів, асоційована із системним червоним вовчаком, хвороба легенів, асоційована з дерматоміозитом/поліміозитом, хвороба легенів, асоційована із синдромом С’єгрена, хвороба легенів, асоційована з анкілозуючим спондилітом, васкулярне дифузне захворювання легенів, хвороба легенів, асоційована з гемосидерозом, інтерстиціальна хвороба легенів, індукована лікарськими засобами, фіброз, променевий фіброз, облітеруючий бронхіоліт, хронічна еозинофільна пневмонія, хвороба легенів, що викликана інфільтрацією лімфоцитів, постінфекційна інтерстиціальна хвороба 11 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 легенів, подагричний артрит, автоімунний гепатит, автоімунний гепатит типу-1 (класичний автоімунний або вовчаковий гепатит), автоімунний гепатит типу-2 (гепатит, викликаний антиLKM антитілами), автоімунна гіпоглікемія, інсулінорезистентність типу B, що супроводжується чорним акантозом, гіпопаратиреоїдит, гостре імунне захворювання, асоційоване з трансплантацією органів, хронічне імунне захворювання, асоційоване з трансплантацією органів, остеоартроз, первинний склерозуючий холангіт, псоріаз типу 1, псоріаз типу 2, ідіопатична лейкопенія, автоімунна нейтропенія, ниркове захворювання без зазначення діагнозу, гломерулонефрит, мікроскопічний васкуліт нирок, хвороба Лайма, дисковидний червоний вовчак, ідіопатична безплідність у чоловіків або безплідність у чоловіків без зазначення діагнозу, автоімунна безплідність, що викликана утворенням антитіл до сперматозоїдів, розсіяний склероз (усіх підтипів), симпатична офтальмія, легенева гіпертензія, що викликана захворюванням сполучних тканин, синдром Гудпасчера, нодозний поліартеріїт, що виявляється ураженням легенів, гостра ревматична лихоманка, ревматоїдний спондиліт, хвороба Стілла, системний склероз, синдром С’єгрена, хвороба Такаясу/артеріт, автоімунна тромбоцитопенія, ідіопатична тромбоцитопенія, автоімунне захворювання щитовидної залози, гіпертиреоїдит, зобний автоімунний гіпотиреоїдит (хвороба Хашимото), атрофічний автоімунний гіпотереоїдит, первинна мікседема, факогенний увеїт, первинний васкуліт, гостре захворювання печінки при вітиліго, хронічні захворювання печінки, алкогольний цироз, ураження печінки, що викликане алкоголем, холеосататит, ідіосинкратичне захворювання печінки, гепатит, індукований лікарськими засобами, не-алкогольний стеатогепатит, алергія та астма, інфекційне захворювання, що викликане стрептококами групи В (GBS), розумові розлади (наприклад, депресія і шизофренія), захворювання, опосередковані лімфоцитами типу T Н2 і TН1, гострий і хронічний біль (різні форми болю), і ракові захворювання, такі як рак легенів, молочної залози, шлунка, сечового міхура, товстої кишки, підшлункової залози, яєчника, передміхурової залози і прямої кишки, і злоякісні захворювання гемопоетичної системи (лейкоз і лімфома), ліпопротеїмія альфа,бета, акроціаноз, гострі і хронічні паразитарні або інфекційні захворювання, гострий лейкоз, гострий лімфобластний лейкоз (ГЛЛ), гострий мієлоїдний лейкоз (ГМЛ), гостра або хронічна бактеріальна інфекція, гострий панкреатит, гостра ниркова недостатність, аденокарцинома, ектопічні передсердні скорочення, комплекс “СНІД-деменція”, алкогольний гепатит, алергічний кон’юнктивіт, алергічний контактний дерматит, алергічний риніт, відторгнення алотрансплантата, хвороба, що викликана дефіцитом альфа-1антитрипсину, аміотрофічний бічний склероз, анемія, стенокардія, дегенерація клітин переднього рога, захворювання, що викликане лікуванням анти-С3 антитілами, антифосфоліпідний синдром, імунні реакції, асоційовані з гіперчутливістю до антитіл проти рецепторів, аневризми аорти і периферичних органів, відшаровування аорти, артеріальна гіпертензія, артеріосклероз, артеріовенозні свищі, атаксія, фібриляція передсердь (уповільнена або пароксизмальна), тріпотіння передсердь, атріовентрикулярна блокада, B-клітинна лімфома, відторгнення кісткового трансплантата, відторгнення трансплантата кісткового мозку (BMT), блокада ніжки пучка Гіса, лімфома Беркіта, опіки, серцева аритмія, синдром зупинки серця, пухлини серця, кардіоміопатія, запальна відповідь, асоційована із кардіопульмонарним шунтуванням, відторгнення хрящового трансплантата, дегенерація кіркової речовини мозочка, розлади мозочка, хаотична або мультифокальна передсердна тахікардія, розлади, асоційовані з хіміотерапією, хронічний мієлоцитарний лейкоз (ХМЛ), хронічний алкоголізм, хронічні запальні патології, хронічний лімфоцитарний лейкоз (ХЛЛ), хронічне обструктивне захворювання легенів (ХОЗЛ), хронічна інтоксикація саліцилатом, карцинома прямої та ободової кишки, застійна серцева недостатність, кон’юнктивіт, контактний дерматит, легеневе серце, захворювання коронарної артерії, хвороба Крейцфельда-Якоба, сепсис, що викликаний негативною культурою, кістозний фіброз, захворювання, асоційовані з цитокіновою терапією, деменція боксерів, димієлінізуючі захворювання, геморагічна лихоманка денге, дерматит, шкірні хвороби, діабет, цукровий діабет, діабетичне атеросклеротичне захворювання, хвороба дифузних тілець Леві, застійна кардіоміопатія, захворювання базальних гангліїв, синдром Дауна в середньому віці, розлади рухових функцій, індуковані лікарськими засобами, що блокують допамінові рецептори ЦНС, чутливість до лікарських засобів, екзема, енцефаломієліт, ендокардит, ендокринопатія, епіглотит, інфекційне захворювання, що викликане вірусом Епштейна-Бара, еритромелалгія, порушення функцій екстрапірамідного шляху і мозочка, спадковий гематофагоцитарний лімфогістіоцитоз, відторгнення імплантату тимуса плоду, атаксія Фрідріха, захворювання функціональних периферичних артерій, сепсис, що викликаний грибами, газова гангрена, виразка шлунка, гломерулонефрит, відторгнення трансплантата будь-яких органів або тканин, сепсис, що викликаний грам-негативними бактеріями, сепсис, що викликаний грампозитивними бактеріями, гранулеми, що викликані внутрішньоклітинними мікроорганізмами, 12 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 ретикулоендотеліоз, хвороба Халервордена-Шпатца, тиреоїдит Хашимото, сінна лихоманка, відторгнення трансплантата серця, гемахроматоз, гемодіализ, гемолітичний уремічний синдром/тромболітична тромбоцитопенічна пурпура, геморагія, гепатит (А), аритмії пучка Гіса, ВІЛ-інфекція/ВІЛ-невропатія, хвороба Ходжкіна, порушення гіперкінетичної рухової активності, реакція гіперчутливості, пневмоніт, асоційований із гіперчутливістю, гіпертензія, порушення гіпокінетичної рухової активності, порушення функції осі гіпоталамуса-гіпофіза-кори надниркових залоз, ідіопатична хвороба Адісона, ідіопатичний фіброз легенів, цитотоксичність, опосередкована антитілом, астенія, атрофія м’язів спинного мозку в дітей, запалення аорти, грип, що викликаний вірусом А, захворювання, що викликане іонізуючим опроміненням, іридоцикліт/увеїт/нейрит зорового нерва, реперфузійне ушкодження при ішемії, ішемічний інсульт, ювенільний ревматоїдний артрит, ювенільна атрофія м’язів спинного мозку, саркома Капоші, відторгнення ниркового трансплантата, хвороба, що викликана бактерією Legionella, лейшманіоз, лепра, ураження кортикоспінальної системи, жировий набряк, відторгнення трансплантата печінки, лімфедема, малярія, злоякісна лімфома, злоякісний гістіоцитоз, злоякісна меланома, менінгіт, менінгококцемія, метаболічні/ідіопатичні розлади, головний біль при мігрені, мітохондріальний розлад багатьох органів, змішане захворювання сполучної тканини, моноклональна гамопатія, множинна мієлома, дегенерація багатьох органів (МенцеляДежерина-Томаса-Ши-Драгера і Мачадо-Йозефа), важка міастенія, захворювання, що викликане внутрішньоклітинною бактерією Мycobacterium avium, туберкульоз, що викликаний мікобактерією, мієлодипластичний синдром, інфаркт міокарда, ішемія міокарда, карцинома носоглотки, хронічне захворювання легенів у немовлят, нефрит, нефроз, нейродегенеративні захворювання, нейрогенна атрофія м’язів I, нейтропенічна лихоманка, не-ходжкінська лімфома, закупорка черевної аорти і її гілок, оклюзійний артеріальний розлад, захворювання, асоційоване з терапією okt3, орхіт/епідидиміт, орхіт/операція з оборотної вазектомії, органомегалія, остеопороз, відторгнення трансплантата підшлункової залози, карцинома підшлункової залози, паранеопластичний синдром/злоякісна гіперкальціємія, відторгнення трансплантата паращитовидної залози, запальне захворювання ділянки таза, цілорічний риніт, перикардит, атеросклеротичне захворювання периферичних органів, розлади периферичних судин, перитоніт, перніціозна анемія, пневмонія, що викликана пневмоцистою Сarinii, пневмонія, синдром POEMS (поліневропатія, органомегалія, ендокринопатія, моноклональна гаммопатія і синдром зміни структури шкіри), постреперфузійний синдром, постгемодіалізний синдром, постміокардіотомічний синдром, прееклампсія, прогресуючий надядерний параліч, первинна легенева гіпертензія, порушення, асоційовані з променевою терапією, феномен і хвороба Рейно, хвороба Рейно, хвороба Рефсума, тахіаритмія, що викликана звуженням комплексів QRS, вазоренальна гіпертензія, реперфузійне ушкодження, рестриктивна кардіоміопатія, саркома, склеродермія, сенільна хорея, сенільна деменція, що викликана тельцями Леві, серонегативні артропатії, інсульт, серповидноклітинна анемія, відторгнення шкірного трансплантата, синдром зміни структури шкіри, відторгнення трансплантата тонкої кишки, солідні пухлини, специфічна аритмія, атаксія спинного мозку, дегенерація спинного мозку і мозочка, міозит, що викликаний стрептококами, структурні ураження мозочка, підгострий склерозуючий паненцефаліт, синкопе, сифіліс серцево-судинної системи, системний анафілактичний шок, синдром системної запальної реакції, системний юнацький ревматоїдний артрит, T-клітинний ГЛЛ або ФАБ-ГЛЛ, телеангіектазія, облітеруючий тромбоангіїт, тромбоцитопенія, токсикоз, розлад, асоційований із трансплантацією органів, травма/геморагія, реакції гіперчутливості типу М, реакції гіперчутливості типу IV, нестабільна стенокардія, уремія, уросепсис, кропив’янка, захворювання серцевого клапана, варикозне розширення вен, васкуліт, захворювання вен, венозний тромбоз, фібриляція шлуночків, вірусні і грибкові інфекції, летальний енцефаліт/асептичний менінгіт, гемафагоцитарний синдром із летальним результатом, синдром Верніке-Корсакова, хвороба Вільсона і відторгнення ксенотрансплантата будь-яких органів або тканин. До обсягу даного винаходу входить анти-IL-12/IL-23 антитіло, що було піддано дозріванню афінності. Фахівцям відома множина методів дозрівання афінності антитіл. Багато-які з них основані на загальній стратегії генерування панелей або бібліотек варіантів білків, одержаних за допомогою мутагенезу, із наступним добором і/або скринінгом на підвищену афінність. Мутагенез часто здійснюють на рівні ДНК, наприклад, за допомогою ПЛР з імовірністю похибки (Thie 2009), шляхом перестановки генів (Kolkman 2001), із використанням мутагенних хімічних речовин або шляхом опромінення, із використанням штамів-“мутаторів”, що діють по механізму реплікації з імовірністю похибки (Greener 1996), або методами соматичної гіпермутації, в яких використовується природний механізм дозрівання афінності (Peled 2008). Мутагенез може бути 13 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 також здійснений на рівні РНК, наприклад, із використанням реплікази Qβ (Kopsidas 2006). Методи з використанням бібліотек, що дозволяють здійснювати скринінг на поліпшені варіанти білків, можуть бути розроблені на основі різних технологій представлення, таких як технології на основі фагів, дріжджів, рибосоми, клітин або бактерій ссавців, добре відомі фахівцям (Benhar 2007). Дозрівання афінності може бути досягнуте з застосуванням більш спрямованих/прогностичних методів, наприклад, методів сайт-спрямованого мутагенезу або синтезу генів, проведеного з використанням даних за 3-мірним моделюванням білка (див., наприклад, Queen 1989; або патенти США № 6180370; або 5225539). Відповідно до цього, даний винахід стосується способу продукування антигензв’язуючого домену, що зв’язується з людським IL-12p40, де зазначений спосіб включає: a. додавання, делецію, заміну або інсерцію однієї або більше амінокислот в амінокислотній послідовності батьківського домену VH, що містить HCDR1, HCDR2 і HCDR3, де батьківські домени VH HCDR1, HCDR2 і HCDR3 являють собою серію визначених вище CDR; і домену VH, що являє собою амінокислотну послідовність варіанта батьківського домену VH, з наступним об’єднанням, але необов’язково, одержаного в такий спосіб домену VH з одним або більше доменами VL з одержанням однієї або більш комбінацій VH/VL; і b. тестування зазначеного домену VH, що являє собою варіант амінокислотної послідовності батьківського домену VH або комбінації або комбінацій VH/VL для ідентифікації антигенз’язуючого домену антитіла проти людського IL-12p40. При цьому, переважно, щоб батьківський домен VH мав амінокислотну послідовність, представлену в SEQ ID NO: 6, SEQ ID NO: 62, SEQ ID NO: 114, SEQ ID NO: 142, SEQ ID NO: 28, SEQ ID NO: 87, SEQ ID NO: 115, SEQ ID NO: 143, SEQ ID NO: 29, SEQ ID NO: 88, SEQ ID NO: 116, SEQ ID NO: 144, SEQ ID NO: 30, SEQ ID NO: 90, SEQ ID NO: 117, SEQ ID NO: 145, SEQ ID NO: 31, SEQ ID NO: 91, SEQ ID NO: 118, SEQ ID NO: 146, SEQ ID NO: 33, SEQ ID NO: 92, SEQ ID NO: 119, SEQ ID NO: 147, SEQ ID NO: 34, SEQ ID NO: 93, SEQ ID NO: 120, SEQ ID NO: 148, SEQ ID NO: 35, SEQ ID NO: 94, SEQ ID NO: 122, SEQ ID NO: 149, SEQ ID NO: 36, SEQ ID NO: 95, SEQ ID NO: 124, SEQ ID NO: 150, SEQ ID NO: 38, SEQ ID NO: 96, SEQ ID NO: 125, SEQ ID NO: 151, SEQ ID NO: 39, SEQ ID NO: 97, SEQ ID NO: 126, SEQ ID NO: 152, SEQ ID NO: 40, SEQ ID NO: 99, SEQ ID NO: 127, SEQ ID NO: 153, SEQ ID NO: 41, SEQ ID NO: 100, SEQ ID NO: 128, SEQ ID NO: 154, SEQ ID NO: 42, SEQ ID NO: 101, SEQ ID NO: 129, SEQ ID NO: 155, SEQ ID NO: 43, SEQ ID NO: 102, SEQ ID NO: 130, SEQ ID NO: 156, SEQ ID NO: 44, SEQ ID NO: 103, SEQ ID NO: 131, SEQ ID NO: 157, SEQ ID NO: 45, SEQ ID NO: 104, SEQ ID NO: 132, SEQ ID NO: 158, SEQ ID NO: 53, SEQ ID NO: 105, SEQ ID NO: 133, SEQ ID NO: 159, SEQ ID NO: 54, SEQ ID NO: 106, SEQ ID NO: 134, SEQ ID NO: 160, SEQ ID NO: 55, SEQ ID NO: 107, SEQ ID NO: 135, SEQ ID NO: 161, SEQ ID NO: 56, SEQ ID NO: 108, SEQ ID NO: 136, SEQ ID NO: 162, SEQ ID NO: 57, SEQ ID NO: 109, SEQ ID NO: 137, SEQ ID NO: 163, SEQ ID NO: 58, SEQ ID NO: 110, SEQ ID NO: 138, SEQ ID NO: 164, SEQ ID NO: 59, SEQ ID NO: 111, SEQ ID NO: 139, SEQ ID NO: 165, SEQ ID NO: 60, SEQ ID NO: 112, SEQ ID NO: 140, SEQ ID NO: 166, SEQ ID NO:61, SEQ ID NO:113, SEQ ID NO:141 або SEQ ID NO:167. Домен VH, що має модифіковану амінокислотну послідовність батьківського домену VH, може бути одержаний за допомогою мутагенезу CDR. У цьому способі, один або більш доменів VL одержують шляхом додавання, делеції, заміни або інсерції однієї або більше амінокислот в амінокислотній послідовності батьківського домену VL, що містить LCDR1, LCDR2 і LCDR3, де батьківський домен VL LCDR1, LCDR2 і LCDR3 являють собою серію CDR VL, визначених вище, у результаті чого утворюються один або більше доменів VL, кожен з яких має модифіковану амінокислотну послідовність батьківського домену VL. При цьому, переважно, щоб батьківський домен VL мав амінокислотну послідовність, представлену в SEQ ID NO: 7, SEQ ID NO: 169, SEQ ID NO: 181, SEQ ID NO: 193, SEQ ID NO: 32, SEQ ID NO: 170, SEQ ID NO: 182, SEQ ID NO: 194, SEQ ID NO: 37, SEQ ID NO: 171, SEQ ID NO: 183, SEQ ID NO: 195, SEQ ID NO: 42, SEQ ID NO: 172, SEQ ID NO: 184, SEQ ID NO: 196, SEQ ID NO: 46, SEQ ID NO: 173, SEQ ID NO: 185, SEQ ID NO: 197, SEQ ID NO: 47, SEQ ID NO: 174, SEQ ID NO: 186, SEQ ID NO: 198, SEQ ID NO: 48, SEQ ID NO: 175, SEQ ID NO: 187, SEQ ID NO: 199, SEQ ID NO: 49, SEQ ID NO: 176, SEQ ID NO: 188, SEQ ID NO: 200, SEQ ID NO: 50, SEQ ID NO: 177, SEQ ID NO: 189, SEQ ID NO: 201, SEQ ID NO: 51, SEQ ID NO: 178, SEQ ID NO:190, SEQ ID NO:52, SEQ ID NO:179 або SEQ ID NO:192. Домен VL, що являє собою модифіковану амінокислотну послідовність батьківського домену VL, може бути одержаний за допомогою мутагенезу CDR. Антигензв’язувальний домен антитіла може бути одержаний у вигляді компонента молекули антитіла IgG, scFv або Fab. 14 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 Даний винахід також стосується способу одержання антигензв’язувального домену, що зв’язується з людським IL-12p40, де зазначений спосіб включає: a. забезпечення вихідної нуклеїнової кислоти, що кодує домен VH, або вихідного набору нуклеїнових кислот, кожна з яких кодує домен VH, де зазначений домен VH вибраний із групи, що складається з SEQ ID NO: 6, SEQ ID NO: 62, SEQ ID NO: 114, SEQ ID NO: 142, SEQ ID NO: 28, SEQ ID NO: 87, SEQ ID NO: 115, SEQ ID NO: 143, SEQ ID NO: 29, SEQ ID NO: 88, SEQ ID NO: 116, SEQ ID NO: 144, SEQ ID NO: 30, SEQ ID NO: 90, SEQ ID NO: 117, SEQ ID NO: 145, SEQ ID NO: 31, SEQ ID NO: 91, SEQ ID NO: 118, SEQ ID NO: 146, SEQ ID NO: 33, SEQ ID NO: 92, SEQ ID NO: 119, SEQ ID NO: 147, SEQ ID NO: 34, SEQ ID NO: 93, SEQ ID NO: 120, SEQ ID NO: 148, SEQ ID NO: 35, SEQ ID NO: 94, SEQ ID NO: 122, SEQ ID NO: 149, SEQ ID NO:36, SEQ ID NO: 95, SEQ ID NO: 124, SEQ ID NO: 150, SEQ ID NO: 38, SEQ ID NO: 96, SEQ ID NO: 125, SEQ ID NO: 151, SEQ ID NO: 39, SEQ ID NO: 97, SEQ ID NO: 126, SEQ ID NO: 152, SEQ ID NO: 40, SEQ ID NO: 99, SEQ ID NO: 127, SEQ ID NO: 153, SEQ ID NO: 41, SEQ ID NO: 100, SEQ ID NO: 128, SEQ ID NO: 154, SEQ ID NO: 42, SEQ ID NO: 101, SEQ ID NO: 129, SEQ ID NO: 155, SEQ ID NO: 43, SEQ ID NO: 102, SEQ ID NO: 130, SEQ ID NO: 156, SEQ ID NO: 44, SEQ ID NO: 103, SEQ ID NO: 131, SEQ ID NO: 157, SEQ ID NO: 45, SEQ ID NO: 104, SEQ ID NO: 132, SEQ ID NO: 158, SEQ ID NO: 53, SEQ ID NO: 105, SEQ ID NO: 133, SEQ ID NO: 159, SEQ ID NO: 54, SEQ ID NO: 106, SEQ ID NO: 134, SEQ ID NO: 160, SEQ ID NO: 55, SEQ ID NO: 107, SEQ ID NO: 135, SEQ ID NO: 161, SEQ ID NO: 56, SEQ ID NO: 108, SEQ ID NO: 136, SEQ ID NO: 162, SEQ ID NO: 57, SEQ ID NO: 109, SEQ ID NO: 137, SEQ ID NO: 163, SEQ ID NO: 58, SEQ ID NO: 110, SEQ ID NO: 138, SEQ ID NO: 164, SEQ ID NO: 59, SEQ ID NO: 111, SEQ ID NO: 139, SEQ ID NO: 165, SEQ ID NO:60, SEQ ID NO: 112, SEQ ID NO: 140, SEQ ID NO: 166, SEQ ID NO: 61, SEQ ID NO: 113, SEQ ID NO: 141 і SEQ ID NO: 167;; b. об’єднання зазначеної вихідної нуклеїнової кислоти або вихідного набору таких нуклеїнових кислот із донорною нуклеїновою кислотою або з донорними нуклеїновими кислотами, що кодують зазначену амінокислотну послідовність або продуковані шляхом введення мутації в зазначену амінокислотну послідовність, так, щоб зазначена донорна нуклеїнова кислота або донорні нуклеїнові кислоти були вбудовані в домен VH вихідної нуклеїнової кислоти або вихідного набору нуклеїнових кислот, з одержанням набору продуктів нуклеїнових кислот, що кодують домени VH; і експресію нуклеїнових кислот зазначеного набору продуктів з одержанням продукту доменів VH; c. об’єднання, але необов’язково, зазначеного продукту доменів VH з одним або більше доменами VL; d. відбір антигензв’язувального домену антитіла проти людського IL-12p40; e. виділення зазначеного антигензв’язувального домену або нуклеїнової кислоти, що кодує цей домен, де зазначений антигензв’язувальний домен містить продукт домену VH і необов’язково домену VL. Даний винахід також стосується способу одержання антигензв’язувального домену, який зв’язується з людським IL-12p40, де зазначений спосіб включає: a. забезпечення вихідної нуклеїнової кислоти, що кодує домен VL, або вихідного набору нуклеїнових кислот, кожна з яких кодує домен VL, де зазначений домен VL вибраний із групи, що складається з: SEQ ID NO: 7, SEQ ID NO: 169, SEQ ID NO: 181, SEQ ID NO: 193, SEQ ID NO: 32, SEQ ID NO: 170, SEQ ID NO: 182, SEQ ID NO: 194, SEQ ID NO: 37, SEQ ID NO: 171, SEQ ID NO: 183, SEQ ID NO: 195, SEQ ID NO: 42, SEQ ID NO: 172, SEQ ID NO: 184, SEQ ID NO: 196, SEQ ID NO: 46, SEQ ID NO: 173, SEQ ID NO: 185, SEQ ID NO: 197, SEQ ID NO: 47, SEQ ID NO: 174, SEQ ID NO: 186, SEQ ID NO: 198, SEQ ID NO: 48, SEQ ID NO: 175, SEQ ID NO: 187, SEQ ID NO: 199, SEQ ID NO: 49, SEQ ID NO: 176, SEQ ID NO: 188, SEQ ID NO: 200, SEQ ID NO: 50, SEQ ID NO: 177, SEQ ID NO: 189, SEQ ID NO: 201, SEQ ID NO: 51, SEQ ID NO: 178, SEQ ID NO: 190, SEQ ID NO: 52, SEQ ID NO: 179 і SEQ ID NO: 192; b. об’єднання зазначеної вихідної нуклеїнової кислоти або вихідного набору таких нуклеїнових кислот із донорною нуклеїновою кислотою або з донорними нуклеїновими кислотами, що кодують зазначену амінокислотну послідовність або продукованими шляхом введення мутації в зазначену амінокислотну послідовність, так, щоб зазначена донорна нуклеїнова кислота або донорні нуклеїнові кислоти були вбудовані в домен VL вихідної нуклеїнової кислоти або вихідного набору нуклеїнових кислот, з одержанням набору продуктів нуклеїнових кислот, що кодують домени VL; і експресію нуклеїнових кислот зазначеного набору продуктів з одержанням продукту доменів VL; c. об’єднання, але необов’язково, зазначеного продукту доменів VL з одним або більше доменами VH; 15 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 d. відбір антигензв’язувального домену антитіла проти людського IL-12p40; e. виділення зазначеного антигензв’язувального домену або нуклеїнової кислоти, що кодує цей домен, де зазначений антигензв’язувальний домен містить продукт домену VH і необов’язково домену VL. У цих способах, донорні нуклеїнові кислоти можуть бути одержані шляхом мутації зазначеної HCDRI і/або HCDR2 і/або HCDR3. Донорна нуклеїнова кислота може бути також одержана шляхом довільної мутації нуклеїнової кислоти. Антитіло відповідно до винаходу може бути вибране із широкого ряду молекул антитіл, добре відомих фахівцям. У деяких варіантах винаходу, антитіло вибране з групи, що складається з молекули імуноглобуліну, моноклонального антитіла (mAb), химерного антитіла, CDR-прищепленого антитіла, гуманізованого антитіла, спільно гуманізованого антитіла, “приватизованого” антитіла, домену антитіла, фрагмента верблюжого антитіла, Fab-, Fab-, F(ab)2-, Fv-, scFv-фрагментів, Fv із дисульфідним зв’язком, діантитіла, полівалентного антитіла, антитіла з подвійною специфічністю, біспецифічного антитіла, домену, що зв’язується з константною ділянкою імуноглобуліну, і білкового остова, до якого приєднані антигензв’язувальні домени (приклади наводяться в публікації Qiu et al. 2007 Nat. Biotechnol. 25, 921-9), та їхніх варіантів. Даний винахід також стосується композицій антитіл, нуклеїнових кислот, що кодують такі антитіла, комплементарних нуклеїнових кислот, векторів, клітин-хазяїв, композицій, препаратів, пристроїв, трансгенних тварин, трансгенних рослин, і способів їхнього одержання і застосування, описаних і розглянутих у даній заявці, у комбінації з об’єктами, уже відомими фахівцям. Даний винахід стосується виділених молекул нуклеїнової кислоти, що включають полінуклеотид, що кодує специфічні антитіла або їхні варіанти, що містять принаймні одну специфічну послідовність, або її домен, або частину варіанта, а також молекул, комплементарних зазначеному полінуклеотиду або що гібридизуються з зазначеним полінуклеотидом. Даний винахід стосується рекомбінантних векторів, що містять зазначені молекули нуклеїнової кислоти, що кодують антитіла, клітин-хазяїнів, що містять такі нуклеїнові кислоти і/або рекомбінантні вектори, а також способів одержання і/або застосування зазначених нуклеїнових кислот, що кодують антитіла, векторів і/або клітин-хазяїнів, що містять такі антитіла. Даний винахід також стосується принаймні однієї композиції, що включає (a) виділене антитіло, його специфічну частину або варіант; нуклеїнову кислоту, що їх кодує, і/або антитіло, описане в даній заявці; і (b) придатний носій або розріджувач. Такий носій або розріджувач може бути, але необов’язково, фармацевтично прийнятним носієм або розріджувачем, звичайно використовуваним у відомих методах. Така композиція може також включати, але необов’язково, принаймні одну іншу сполуку, білок або композицію. Даний винахід також стосується принаймні одного способу експресії антитіл або їхніх варіантів у клітинах-хазяях, де зазначений спосіб включає культивування клітини-хазяїна, описаної в даній заявці і/або відомої фахівцям, в умовах, за яких таке антитіло або його варіант експресується у виділюваних кількостях. Даний винахід стосується нуклеїнової кислоти, що кодує принаймні одне антитіло, і що включає нуклеїнову кислоту, яка гібридизується з нуклеїновою кислотою, що кодує антитіло, у жорстких умовах, або має послідовність, що принаймні на 95 % ідентична послідовності зазначеної нуклеїнової кислоти. Даний винахід також стосується виділеного антитіла, що кодується зазначеною нуклеїновою кислотою. Даний винахід також стосується вектора, що кодує антитіло і містить таку нуклеїнову кислоту, де зазначений вектор також включає, але необов’язково, принаймні один промотор, вибраний із групи, що складається з пізнього або раннього промотору SV40, промотору CMV, промотору HSV tk, промотору pgk, промотору людського імуноглобуліну і промотору EF-1α. Такий вектор може також включати, але необов’язково, принаймні один селективний ген або його частину, вибрані принаймні з генів метотрексату (MTX), дигідрофолат-редуктази (DHFR), білка, що флуоресціює у зеленому діапазоні спектра (GFP), неоміцину (G418) або глутамін-синтетази (GS). Даний винахід також включає клітину-хазяїна ссавця, що містить, але необов’язково, зазначену виділену нуклеїнову кислоту, де зазначеним хазяїном є принаймні один хазяїн, вибраний із клітин COS-1, COS-7, HEK293, BHK21, CHO, BSC-1, Hwp2, PerCP, 653, SP2/0, 293, HeLa, мієломи або лімфоми, або будь-яких їхніх похідних, або імморталізованих або трансформованих клітин. Даний винахід також стосується принаймні одного способу одержання композиції, що містить принаймні одне антитіло, де зазначена композиція містить принаймні одне антитіло, а також, але необов’язково, носій або розріджувач, де зазначений носій або розріджувач є фармацевтично прийнятними і/або де зазначена композиція також містить принаймні одну сполуку або білок, вибрані з антагоніста TNF, протиревматичного засобу, м’язового релаксанту, 16 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 наркотичного засобу, нестероїдного протизапального засобу (НСПЗЗ), анальгетика, анестетика, седативного засобу, місцевого анестетика, нейром’язового блокатора, протимікробного засобу, засобу проти псоріазу, кортикостероїду, анаболічного стероїду, анти-IL-23 антитіла, анти-IL-12 антитіла, мікроелементів, живильних речовин, тиреотропного засобу, вітаміну, гормону кальцитоніну, засобу проти діареї, засобу проти кашлю, протиблювотного засобу, противиразкового засобу, проносного, антикоагулянту, еритропоетину, філграстиму, сарграмостиму, імунізуючого засобу, імуноглобуліну, імунодепресанта, гормону росту, лікарського засобу для гормон-замісної терапії, модулятора рецептора естрогену, мідріатичного засобу, засобу проти циклоплегії, алкілуючого агента, антиметаболіту, інгібітору мітозу, радіофармацевтичного засобу, антидепресанту, засобу проти маніакально-депресивних розладів, антипсихотичного засобу, анксіолітика, гіпнотичного засобу, симпатоміметика, стимулятора, донепезилу, такрину, протиастматичного засобу, бета-агоніста, стероїду, що вводиться шляхом інгаляції, інгібітору лейкотрієну, метилксантину, кромоліну, епінефрину або його аналога, дорнази-альфа, цитокіну та антагоніста цитокіну. Даний винахід також стосується принаймні одного способу лікування стану, асоційованого з IL-12/23, що є присутніми у клітині, тканині, органі або в організмі тварини, де зазначений спосіб включає контактування принаймні одного антитіла з зазначеними клітиною, тканиною, органом або організмом тварини, або введення, але необов’язково, зазначеного принаймні одного антитіла в зазначені клітину, тканину, органи або організм тварини в кількості, яка є ефективною для модуляції імуно-опосередкованого стану або інфекційного стану, і де зазначеною твариною є примат, необов’язково, мавпа або людина. Зазначений спосіб може також включати, але необов’язково, введення в зазначені клітини, тканини, органи або організм тварини ефективної кількості антитіла, що складає приблизно 0,001-100 мг/кілограм зазначених клітин, тканин, органів або організму тварини. Зазначений спосіб може також включати зазначене контактування або введення, здійснювані принаймні одним способом, вибраним із внутрішньовенного введення, внутрішньом’язового введення, введення у вигляді болюсу, внутрішньочеревинного введення, підшкірного введення, введення в дихальні шляхи, введення шляхом інгаляції, місцевого введення, інтраназального введення, вагінального введення, ректального введення, трансбукального введення, під’язикового введення, інтраназального введення, підшкірного і трансдермального введення. Такий спосіб може також включати введення до, під час або після зазначеного контактування або введення принаймні однієї композиції, що містить терапевтично ефективну кількість принаймні однієї сполуки або білка, вибраних принаймні з антагоніста TNF, протиревматичного засобу, м’язового релаксанту, наркотичного засобу, нестероїдного протизапального засобу (НСПЗЗ), анальгетика, анестетика, седативного засобу, місцевого анестетика, нейром’язового блокатора, протимікробного засобу, засобу проти псоріазу, кортикостероїду, анаболічного стероїду, анти-IL-23 антитіла, анти-IL-12 антитіла, мікроелементів, поживних речовин, тиреотропного засобу, вітаміну, гормону кальцитоніну, засобу проти діареї, засобу проти кашлю, протиблювотного засобу, противиразкового засобу, проносного, антикоагулянту, еритропоетину, філграстиму, сарграмостину, імунізуючого засобу, імуноглобуліну, імунодепресанта, гормону росту, лікарського засобу для гормон-замісної терапії, модулятора рецептора естрогену, мідріатичного засобу, засобу проти циклоплегії, алкілувального агента, антиметаболіту, інгібітору мітозу, радіофармацевтичного засобу, антидепресанту, засобу проти маніакально-депресивних розладів, антипсихотичного засобу, анксіолітика, гіпнотичного засобу, симпатоміметика, стимулятора, донепезилу, такрину, протиастматичного засобу, бета-агоніста, стероїду, що вводиться шляхом інгаляції, інгібітору лейкотрієну, метилксантину, кромоліну, епінефрину або його аналога, дорнази-альфа, цитокіну та антагоніста цитокіну. Даний винахід також включає принаймні один препарат, що містить принаймні одне антитіло і принаймні один препарат для одержання композиції, де зазначений препарат вибраний зі стерильної води, стерильної забуференої води або принаймні одного консерванту, вибраного з групи, що складається з фенолу, м-крезолу, п-крезолу, о-крезолу, хлоркрезолу, бензилового спирту, алкілпарабену, хлориду бензалконію, хлориду бензетонію, дегідроацетату натрію і тимерозалу або їхніх сумішей, необов’язково, у водному розріджувачі, де концентрація білка складає приблизно від 0,1 мг/мл до 100 мг/мл, і де зазначений препарат містить принаймні один агент, що додає ізотонічність, або принаймні один фізіологічно прийнятний буфер. Даний винахід також стосується принаймні одного промислового виробу, призначеного для фармацевтичного застосування в медицині, де зазначений виріб включає пакувальний матеріал і контейнер, що містить розчин або ліофілізовану форму, принаймні одного антитіла відповідно до винаходу, де зазначений контейнер також являє собою, але необов’язково, скляний або пластиковий контейнер із кришкою для багаторазового застосування, і де зазначений контейнер 17 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 також являє собою, але необов’язково, блістерну упаковку, в якій може бути зроблено прокол і яка може бути використана для внутрішньовенного введення, внутрішньом’язового введення, введення у вигляді болюсу, внутрішньочеревинного введення, підшкірного введення, місцевого введення, введення в дихальні шляхи, введення шляхом інгаляції, інтраназального введення, вагінального введення, ректального введення, трансбукального введення, під’язикового введення, інтраназального введення, підшкірного або трансдермального введення; або зазначений контейнер являє собою компонент пристрою або системи для внутрішньовенного введення, внутрішньом’язового введення, введення у вигляді болюсу, внутрішньочеревинного введення, підшкірного введення, введення в дихальні шляхи, введення шляхом інгаляції, інтраназального введення, вагінального введення, місцевого введення, ректального введення, трансбукального введення, під’язикового введення, інтраназального введення, підшкірного або трансдермального введення; або зазначений контейнер являє собою компонент пристрою або системи у вигляді інжектора або інжектора типу “писального пера” для внутрішньовенного введення, внутрішньом’язового введення, введення у вигляді болюсу, внутрішньочеревинного введення, підшкірного введення, введення у дихальні шляхи, введення шляхом інгаляції, місцевого введення, інтраназального введення, вагінального введення, ректального введення, трансбукального введення, під’язикового введення, інтраназального введення, підшкірного введення або трансдермального введення. Даний винахід також стосується принаймні одного способу продукування принаймні одного антитіла відповідно до винаходу, де зазначений спосіб включає одержання клітини-хазяїна, трансгенної тварини, трансгенної рослини або рослинної клітини, здатної експресувати виділювані кількості зазначеного людського антитіла, і де, але необов’язково, зазначена клітина-хазяїн являє собою клітину ссавця, клітину рослини або дріжджову клітину; зазначеною трансгенною твариною є ссавець, а зазначений трансгенний ссавець вибраний із кіз, корів, овець, коней і приматів, що не є людиною. Даний винахід також стосується принаймні одного способу лікування принаймні одного IL12/23-опосередкованого розладу, де зазначений спосіб включає принаймні (a) введення ефективної кількості композиції або фармацевтичної композиції, що містить принаймні один білок, що зв’язується з клітиною, тканиною, органом або організмом тварини або пацієнта, що потребує такої модуляції, лікування або терапії, а також (b) введення до, під час і/або після введення, описаного вище в (a), принаймні одного засобу, вибраного з імуномодулюючого терапевтичного засобу, антагоніста TNF, протиревматичного засобу, м’язового релаксанту, наркотичного засобу, нестероїдного протизапального засобу (НСПЗЗ), анальгетика, анестетика, седативного засобу, місцевого анестетика, нейром’язового блокатора, протимікробного засобу, засобу проти псоріазу, кортикостероїду, анаболічного стероїду, неврологічного засобу, мікроелементів, поживних речовин, тиреотропного засобу, вітаміну, гормону кальцитоніну, засобу проти діареї, засобу проти кашлю, протиблювотного засобу, противиразкового засобу, проносного, антикоагулянту, еритропоетину, філграстиму, сарграмостиму, імунізуючого засобу, імуноглобуліну, імунодепресанта, гормону росту, лікарського засобу для гормон-замісної терапії, модулятора рецептора естрогену, мідріатичного засобу, засобу проти циклоплегії, алкілувального агента, антиметаболіту, інгібітору мітозу, радіофармацевтичного засобу, антидепресанту, засобу проти маніакально-депресивних розладів, антипсихотичного засобу, анксіолітика, гіпнотичного засобу, симпатоміметика, стимулятора, донепезилу, такрину, протиастматичного засобу, бета-агоніста, стероїду, що вводиться шляхом інгаляції, інгібітору лейкотрієну, метилксантину, кромоліну, епінефрину або його аналога, дорнази-альфа, цитокіну та антагоніста цитокіну. IL-12p40 є присутнім у білках IL-12 і IL-23 та існує у вигляді мономера IL-12p40 і гомодимера IL-12p80. У даному винаході описане антитіло, що зв’язується з IL-12, IL-23, IL-12p40, IL-12p80, та імовірно, зв’язується з будь-якими недавно виявленими білками, що містять субодиницю IL12p40. Зазначене антитіло специфічно зв’язується з IL-12p40, але не з IL-12p35 або IL-23р19. Даний винахід також стосується композицій і препаратів, що містять такі антитіла, способів одержання таких антитіл, пристроїв, що містять зазначені антитіла, і застосування цих антитіл, включаючи терапевтичне застосування. В одному з варіантів винаходу, зазначене антитіло має здатність нейтралізувати зв’язування IL-12 з IL-12Rβ2, який, як вважається, зв’язується з IL-12 у ділянці контакту p40/p35. В іншому варіанті винаходу, зазначене антитіло має здатність інгібувати зв’язування IL-23 з IL-23R, яке, як вважається, опосередковується взаємодіями в ділянці контакту р19/p40. В іншому варіанті винаходу, зазначене антитіло має здатність інгібувати зв’язування IL-12 з IL-12Rβ2 і зв’язування IL-23 з IL-23R. При зв’язуванні з IL-12p40 на ділянці, розташованій біля ділянки контакту з p35 або р19, зазначене антитіло інгібує зв’язування релевантних рецепторів з IL-12 і/або IL-23. 18 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 У даному винаході описані антитіла, що зв’язуються з IL-12p40/80, але не мають здатності нейтралізувати зв’язування IL-12p40 або IL-12p80 з IL-12Rβ1. Регуляція систем IL-12 або IL-23 може бути здійснена за допомогою субодиниці IL-12p40/80 у присутності антитіла, оскільки ці білки вільно зв’язуються з IL-12Rβ1. Перевага такого способу дії полягає в тому, що він дозволяє природним регуляторам системи IL-12 і IL-23 (IL-12p40/p80) зберігати свою здатність конкурувати за зв’язування поряд зантитілом, яке також діє як антагоніст IL-12 і IL-23. Отже, завдяки цьому способу дії може бути одержана система з двох антагоністів, яка надає антитілу більшу ефективність при його використанні у ролі терапевтичного засобу. Це також може поліпшувати профіль безпеки при використанні антитіл, що не інгібують біологічну функцію IL12p40/80. Недавно було показано, що IL-12p40/80 відіграють різні ролі, і крім того, вони виступають у ролі антагоністів і регуляторів шляхів IL-12/IL-23. Зазначене антитіло не перешкоджає дії IL-12p40/80 у ролі хемоатрактантів для макрофагів і у ролі індуктора міграції ДК у відповідь на стимуляцію патогеном. Це може призводити до поліпшення профілю безпеки антитіла при його введенні у ролі терапевтичного засобу. Усі наукові факти, патенти, патентні заявки і технічні описи виробників у всій своїй повноті вводяться в даний опис за допомогою посилання. У даному описі, якщо це не обговорено особливо, при вживанні слова “містити” або інших його граматичних форм, таких як “містить” або “що містить”, мають на увазі, що даний об’єкт включає зазначений елемент або цілі кількості елементів, або групу або цілі кількості елементів, але не виключає присутності будь-якого іншого елемента або цілої кількості елементів, або групу або цілі кількості елементів. Зовсім очевидно, що даний винахід не обмежується конкретно описаними тут компонентами препаратів, методами їхнього одержання, протоколами введення доз і т. ін., що можуть варіюватися, якщо це не обговорено особливо. Слід зазначити, що при вживанні артиклів “a”, “an” і “the” з іменниками в однині мається на увазі, що ці іменники можуть бути присутнім і в множині, якщо це конкретно не випливає з контексту опису. Так, наприклад, іменник з артиклем “a” може означати один, а також два або більше; іменники з артиклем “an” може означати один, а також два або більше; іменники з артиклем “the” може означати один, а також два або більше, і т. ін. Використовуваний тут термін “поліпептид” означає будь-який полімерний ланцюг амінокислот. Використовувані тут терміни “пептид” і “білок” є синонімами терміну “поліпептид” і також означають полімерний ланцюг амінокислот. Термін “поліпептид” охоплює природні або штучні білки, фрагменти білка і поліпептидні аналоги послідовності білка. Поліпептид може бути мономерним або полімерним. Термін “виділений білок” або “виділений поліпептид” являє собою білок або поліпептид, що по своїй природі або походженню не асоціюються з природними компонентами, з якими вони зустрічаються в природі; в основному, не містять інших білків, що походять від того ж виду; експресуються клітинами різних видів або не зустрічаються в природі. Таким чином, поліпептид, який був хімічно синтезований або синтезований у клітинній системі, що відрізняється від клітин, від яких він звичайно походить, може бути “відділений” від компонентів, з якими він асоціюється в природі. Цей білок може бути також, в основному, відділений від усіх його природних компонентів шляхом його виділення з застосуванням методів очищення білків, добре відомих фахівцям. Використовуваний тут термін “виділення” означає спосіб видалення з хімічних молекул, таких як поліпептид, в основному, усіх його природних компонентів шляхом відділення, наприклад, із застосуванням методів очищення білків, добре відомих фахівцям. Використовуваний тут термін “людський IL-12” (що скорочено позначають тут як hIL-12 або IL-12) включає людський цитокін, що секретується, головним чином, антигенпрезентуючими клітинами, такими як моноцити, макрофаги і дендритні клітини. Цей термін включає гетеродимерний білок, що містить субодиницю 35 кД (p35) і субодиницю 40 кД (p40), які зв’язані одна з одною дисульфідним містком. Гетеродимерний білок називається “білком p70”. Термін людський IL-12 включає рекомбінантний людський IL-12 (rhIL-12), який може бути одержаний стандартними рекомбінантними методами експресії. IL-12 належить до сімейства інтерлейкінів, тобто, до самого нового члена цього сімейства, що позначається IL-35, який має загальні властивості із субодиницею IL-12p35 (Niedbala et al. 2007 Eur. J. Immunol. 37 3021-9). Недавнє виявлення IL-35 вказує на те, що існує більше число форм IL-12p40 і IL-12p35, які поки ще не відкриті. Логічно припустити, що антитіла, описані в даній заявці, будуть зв’язуватися з усіма недавно виявленими білками, що містять форми IL-12p40. Використовуваний тут термін “людський IL-23” (що скорочено позначено тут як hIL-23 або IL23) включає гетеродимерний людський цитокін, що належить до сімейства, що складається з 19 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 п’яти таких гетеродимерних цитокінів, включаючи IL-12 і IL-27 (Trinchieri et al. 2003 Immunity 19 641-4). Цей термін включає гетеродимерний білок, що містить субодиниці р19 і p40, які зв’язані одна з одною дисульфідним містком. Термін “людський IL-23” включає рекомбінантний людський IL-23 (rhIL-23), який може бути одержаний стандартними рекомбінантними методами експресії. Використовуваний тут термін “IL-12/23” у своєму збиральному значенні означає людські IL12 і IL-23. Використовуваний тут термін “IL-12p40” ідентичний “IL-23p40”, а також означає просто субодиниці “p40” і “p40”, і включає субодиницю 40 кД людського цитокіну IL-12 (p40) і субодиницю 40 кД людського цитокіну IL-23. Використовуваний тут термін “IL-12p80”, а також просто “р80” означає 2 мономерні субодиниці по 40 кД людського цитокіну IL-12 (p40), зв’язаних разом дисульфідним містком і утворюючих димерний білок. Використовуваний тут термін “IL-12p35”, а також просто “р35” означає субодиницю в 35 кД людських цитокінів IL-12 (p70) і IL-35. Використовуваний тут термін “IL-23р19”, а також просто “р19” означає субодиницю в 19 кД людського цитокіну IL-23. Комплекс IL-12R складається з двох субодиниць, що називають рецептором бета 1 і позначають тут IL-12Rβ1, і рецептором IL-12 бета 2, що позначають тут IL-12Rβ2, і обидва ці рецептора є необхідними для високоафінного зв’язування з IL-12 і передачі сигналу. IL-12R був спочатку охарактеризований на PHA-активованих лімфобластах, і на IL-2-активованих NKклітинах (Chizzonite et al. 1992 J. Immunol. 148 3117-24; Chua et al. 1994 J. Immunol. 153 128-36). Було показано, що IL-12Rβ2 відповідальний за передачу сигналу по шляху Tyk2/JAK2 і STAT4, який направляє клітини далі на шлях T n1 (вивільнення IFN-γ) (Presky et al. 1996 Proc. Natl. Acad. Sci. USA 93 14002-7; Watford et al. 2004 Immunol. Rev. 202 139-56). Тому що було показано, що IL-12Rβ1 бере участь у передачі сигналу фосфорилуючими Tyk2 і STAT3 (Zou et al. 1997 J. Biol. Chem. 272 6073-7). Комплекс IL-23R складається з двох субодиниць: субодиниці IL-12Rβ1, яка присутня в комплексі IL-12R, і субодиниці рецептора IL-23, що позначається тут IL-23R. Зв’язування IL-23R з IL-23 призводить до автофосфорилування JAK2 і до фосфорилування IL-23R. Це дозволяє визначити локалізацію і рівень фосфорилування STAT3, а також STAT1, STAT4 і STAT5 (Parham et al. 2002 J. Immunol. 168 5699-708). Використовуваний тут термін “біологічна активність” означає всі біологічні властивості, властиві даному цитокіну. Біологічними властивостями IL-12 є, але не обмежуються ними, зв’язування IL-12Rβ1 і/або IL-12Rβ2; індукування секреції IFN-γ; і регуляція балансу між антигенспецифічними T-хелперними лімфоцитами типу 1 (T H1) і типу 2 (TН2). Біологічними властивостями IL-23 є, але не обмежуються ними, зв’язування IL-12Rβ1 і/або IL-23R, індукування продукування IFN-γ, індукування продукування IL-17, індукування продукування IL21, індукування продукування IL-22, диференціація TH17-клітин і активація антигенпрезентуючих функцій дендритних клітин, і селективне індукування проліферації T-клітин пам’яті. Терміни “специфічне зв’язування” або “специфічно зв’язується”, якщо вони використовуються тут у зв’язку з взаємодією антитіла, або білка пептиду з іншими хімічними молекулами, означають, що така взаємодія залежить від присутності конкретної структури (наприклад, антигенної детермінанти або епітопу) на хімічних молекулах; так, наприклад, зазначене антитіло розпізнає специфічну білкову структуру, а не білки в цілому, і зв’язується з такою структурою. Якщо антитіло є специфічним до епітопу “А”, то присутність молекули, що містить епітоп “А” (або вільний немічений “А”) у реакційній суміші, що містить мічений “А” і антитіло, буде призводити до зниження кількості міченого “А”, зв’язаного з антитілом. Використовуваний тут термін “антитіло”, у своєму широкому змісті означає будь-яку молекулу імуноглобуліну (Ig), що складається з чотирьох поліпептидних ланцюгів (H), тобто, двох важких ланцюгів (Н) і двох легких ланцюгів (L) або будь-яких їхніх функціональних фрагментів, мутантів, варіантів або похідних, які, власне кажучи, зберігають здатність молекули Ig зв’язуватися з епітопом. Такі мутанти, варіанти або похідні антитіл відомі фахівцям. Варіанти таких молекул, що не обмежуються, обговорюються нижче. У повнорозмірному антитілі, кожен важкий ланцюг складається з варіабельної ділянки важкого ланцюга (що скорочено позначеної тут HCVR або VH) і константної ділянки важкого ланцюга. Константна ділянка важкого ланцюга складається з трьох доменів, СН1, CH2 і CH3. Кожен легкий ланцюг складається з варіабельної ділянки легкого ланцюга (що скорочено позначена тут LCVR або VL) і константної ділянки легкого ланцюга. Константна ділянка легкого ланцюга складається з одного домену CL. Ділянки VH і VL можуть бути також підрозділені на 20 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 гіперваріабельні ділянки, які називають гіперваріабельними ділянками (комплементарністьвизначальними ділянками (CDR)), між якими знаходяться більш консервативні ділянки, які називаються каркасними ділянками (FR). Кожна VH і VL складається з трьох CDR і чотирьох FR, розташованих у наступному порядку, у напрямку від аміно-кінця до карбокси-кінця: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. Молекулами імуноглобуліну можуть бути молекули будь-якого типу (наприклад, IgG, IgE, IgM, IgD, IgA і IgY), класу (наприклад, IgG1, IgG2, IgG3, IgG4, IgA1 і IgA2) або підкласи. Використовувані тут терміни “антигензв’язувальний домен” або “антигензв’язувальна частина” антитіла означає один або більше фрагментів антитіла або білка, який зберігає здатність специфічно зв’язуватися з антигеном (наприклад, з IL-12). Було показано, що антигензв’язувальна функція антитіла може бути реалізована під дією фрагментів повнорозмірного антитіла. Такі варіанти антитіл можуть бути також біспецифічними, і можуть мати подвійну специфічність, або вони можуть бути мультиспецифічними; причому, зазначені варіанти антитіл специфічно зв’язуються з двома або більше різними антигенами. Прикладами зв’язувальних фрагментів, що входять до обсягу терміну “антигензв’язувальна частина” антитіла, є: (і) Fab-фрагмент, одновалентний фрагмент, що складається з доменів VL, VH, CL і СН1; (ii) F(ab)2-фрагмент, двовалентний фрагмент, що включає два Fab-фрагменти, зв’язаних дисульфідним місточковим зв’язком у шарнірній ділянці; (iii) Fd-фрагмент, що складається з доменів VH і СН1; (iv) Fv-фрагмент, що складається з доменів VL і VH однієї гілки антитіла, (v) dAb-фрагмент (Ward et al. 1989 Nature 341 544-6, Winter et al, публікація заявки PCT WO 90/05144 A1, яка вводиться в даний опис за допомогою посилання), що містить один варіабельний домен; і (vi) виділена гіперваріабельна ділянка (CDR). Крім того, хоча два домени Fv-фрагменти, VL і VH, кодуються окремими генами, однак, вони можуть бути приєднані один до одного рекомбінантними методами за допомогою синтетичного лінкеру, що дозволяє одержати один білковий ланцюг, в якому ділянки VL і VH спаровуються з утворенням одновалентних молекул (відомих як одноланцюговий Fv (scFv); (див., наприклад, Bird et al. 1988, Science 242, 423-6; Huston et al. 1988 Proc. Natl. Acad. Sci. USA 85, 5879-83). Такі одноланцюгові антитіла також входять до обсягу терміну “антигензв’язувальна частина” антитіла. В обсяг цього терміну також входять й інші форми одноланцюгових антитіл, такі як діантитіла. Діантитіла являють собою двовалентні біспецифічні антитіла, в яких домени VH і VL експресуються на одному поліпептидному ланцюзі, але за допомогою лінкеру, який є занадто коротким для спарювання двох доменів на одному і тому ж ланцюзі, а тому ці домени змушені спаровуватися з комплементарними доменами іншого ланцюга й утворюють два антигензв’язувальні сайти (див., наприклад, Holliger, P., et al., 1993, Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, R. J., et al., 1994, Structure 2:1121-1123). Такі антигензв’язувальні частини антитіла відомі фахівцям (Kontermann and Dubel eds., Antibody Engineering 2001 Springer-Verlag. New York. 790 pp., ISBN 3-540-41354-5). Використовуваний тут термін “конструкція антитіла” означає поліпептид, що містить одну або більше антигензв’язувальних частин відповідно до винаходу, зв’язаних із поліпептидним лінкером або константним доменом імуноглобуліну. Лінкерні поліпептиди містять два або більше амінокислотних залишки, зв’язаних пептидними зв’язками, і служать для зв’язування однієї або більше антигензв’язувальних частин. Такі лінкерні поліпептиди добре відомі фахівцям (див., наприклад, Holliger et al. 1993 Proc. Natl. Acad. Sci. USA 90, 6444-8). Термін “константний домен імуноглобуліну” означає константний домен важкого або легкого ланцюга. Амінокислотні послідовності константного домену важкого ланцюга і легкого ланцюга людського IgG відомі фахівцям та їхні приклади наводяться нижче. Константний домен важкого ланцюга людського IgG 1 (або їхні похідні, що є в NCBI, реєстр. No: P01857): ASTKNPDVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Константний домен людського легкого ланцюга каппа (наявний у базі даних NCBI, реєстр. No: P01834): TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDST YSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Константний домен людського легкого ланцюга лямбда (наявний у NCBI, реєстр. №: P01842): QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKY 21 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 AASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS Крім того, антитіло або його антигензв’язувальна частина можуть бути частиною більшої молекули імуноадгезину, утвореною за допомогою ковалентного або нековалентного зв’язування антитіла або його частини з одним або більше іншими білками або пептидами. Прикладами таких молекул імуноадгезину є корова ділянка стрептавідину, що використовується для створення тетрамерної молекули scFv (Kipriyanov et al. 1995 Hum. Antibodies Hybridomas 6, 93-101), а також цистеїновий залишок, маркерний пептид і С-кінцева полігістидинова мітка, що використовуються для створення двовалентного і біотинілованого scFv (Kipriyanov et al. 1994 Mol. Immunol. 31, 1047-58). Частини антитіла, такі як Fab- і F(ab)2-фрагменти, можуть бути одержані з цілих антитіл стандартними методами, такими як гідроліз цілих антитіл папаїном або пепсином, відповідно. Крім того, молекули антитіл, частин антитіл і імуноадгезину можуть бути одержані стандартними методами рекомбінантних ДНК, описаними в даній заявці. Використовуваний тут термін “виділене антитіло” означає антитіло, що, в основному, не містить інших антитіл, що мають іншу антигенну специфічність (наприклад, виділене антитіло, яке специфічно зв’язується з hIL-12, в основному, не містить антитіл, які специфічно зв’язуються з антигенами, що не є hIL-12). Однак, виділене антитіло, що специфічно зв’язується з hIL-12, може перехресно реагувати і з іншими антигенами, такими як молекули IL-12, що походять від інших видів. Крім того, виділене антитіло може, в основному, не містити інший клітинний матеріал і/або інші хімічні сполуки. Використовуваний тут термін “людське антитіло” включає антитіла, що мають варіабельні і константні ділянки, що походять від послідовностей імуноглобуліну людської зародкової лінії. Людські антитіла відповідно до винаходу можуть включати амінокислотні залишки, що не належать послідовностям імуноглобуліну людської зародкової лінії (наприклад, у них можуть бути введені мутації за допомогою неспецифічного або сайт-специфічного мутагенезу in vitro або за допомогою соматичної мутації in vivo), наприклад, такі залишки можуть бути присутніми у СDR, а зокрема, у CDR3. Однак, використовуваний тут термін “людське антитіло” не включає антитіла, в яких послідовності СDR, що походять від зародкової лінії ссавців інших видів, таких як миша, були приєднані до людських каркасних послідовностей. Використовуваний тут термін “рекомбінантне людське антитіло” включає всі людські антитіла, що були одержані, експресовані, сконструйовані або виділені рекомбінантними методами, наприклад, антитіла, експресовані з використанням рекомбінантного експресійного вектора, трансфікованого в клітину-хазяїна; антитіла, виділені з бібліотеки рекомбінантних комбінаторних людських антитіл (Hoogenboom 1997 Trends Biotechnol 15, 62-70; Azzazy et al. 2002 Clin Biochem 35 425-45; Gavilondo et al. 2000 Biotechniques 29 128-32, 134-6, 138 passim Hoogenboom et al. 2000 Immunol Today 21 371-8), антитіла, виділені у тварин (наприклад, мишей), які є трансгенними стосовно генів людського імуноглобуліну (див., наприклад, Taylor et al. 1992 Nucleic Acids Res. 20 6287-95, Little et al. 2000 Immunol. Today 21: 364-70); або антитіла, які були одержані, експресовані, сконструйовані або виділені іншими методами, що включають сплайсинг послідовностей генів людського імуноглобуліну з утворенням інших послідовностей ДНК. Такі рекомбінантні людські антитіла мають варіабельні і константні ділянки, що походять від послідовностей імуноглобуліну людської зародкової лінії. Однак, у деяких варіантах винаходу, такі рекомбінантні людські антитіла піддають мутагенезу in vitro (або, якщо використовується тварина, яка є трансгенною стосовно послідовностей людського Ig, то її піддають соматичному мутагенезу in vivo), і таким чином, амінокислотні послідовності ділянок VH і VL рекомбінантних антитіл являють собою послідовності, які, хоча і походять від послідовностей VH і VL людської зародкової лінії і є спорідненими цим послідовностям, однак, у природі, вони можуть не бути присутніми у репертуарі людських антитіл зародкової лінії in vivo. Термін “химерне антитіло” означає антитіла, які містять послідовності варіабельної ділянки важкого і легкого ланцюга, що походять від одного виду, і послідовності константної ділянки, що походять від інших видів, такі як антитіла, що мають мишачі варіабельні ділянки важкого і легкого ланцюга, приєднані до людських константних ділянок. Термін “CDR-прищеплене антитіло” означає антитіла, що містять послідовності варіабельної ділянки важкого і легкого ланцюга, які походять від одного виду, але в яких послідовності однієї або більше СDR-ділянок VH і/або VL замінені послідовностями СDR інших видів, наприклад, такі антитіла мають мишачі варіабельні ділянки важкого і легкого ланцюга, в яких одна або більше мишачих СDR (наприклад, CDR3) були заміненілюдськими послідовностями CDR. Термін “гуманізоване антитіло” означає антитіла, які містять послідовності варіабельної ділянки важкого і легкого ланцюга, що походять від ссавців, що не є людиною (наприклад, миші), але в яких принаймні частина послідовності VH і/або VL була модифікована для надання їй більшої подібності з послідовністю людського антитіла, тобто, більшої подібності з 22 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 варіабельними послідовностями людської зародкової лінії. Гуманізованим антитілом одного з типів є СDR-прищеплене антитіло, в якому людські послідовності СDR були введені в нелюдські послідовності VH і VL для заміни відповідних не-людських послідовностей СDR. Використовувані тут терміни “нумерація за Кебатом”, “визначення за Кебатом” і “мічення за Кебатом” є синонімами. Ці терміни, відомі фахівцям, означають систему нумерації амінокислотних залишків, які є більш варіабельними (тобто, гіперваріабельними), ніж інші амінокислотні залишки у варіабельних ділянках важкого і легкого ланцюга антитіла або його антигензв’язувальної частини. (Kabat et al. 1971, Ann. NY Acad, Sci. 190:382-391 і Kabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication № 91-3242). Для варіабельної ділянки важкого ланцюга, гіперваріабельна ділянка простягається в межах від амінокислотного положення 31 до амінокислотного положення 35 для CDR1; від амінокислотного положення 50 до амінокислотного положення 65 для CDR2; і від амінокислотного положення 95 до амінокислотного положення 102 для CDR3. Для варіабельної ділянки легкого ланцюга, гіперваріабельна ділянка простягається в межах від амінокислотного положення 24 до амінокислотного положення 34 для CDR1; від амінокислотного положення 50 до амінокислотного положення 56 для CDR2; і від амінокислотного положення 89 до амінокислотного положення 97 для CDR3. Використовувані тут терміни “акцептор” і “акцепторне антитіло” означає послідовність антитіла, що включає амінокислотну послідовність, або послідовність нуклеїнової кислоти, що кодує амінокислотну послідовність, яка принаймні на 80 %, принаймні на 85 %, принаймні на 90 %, принаймні на 95 %, принаймні на 98 % або 100 % ідентична до амінокислотної послідовності однієї або більше каркасних ділянок. У деяких варіантах винаходу, термін “акцептор” означає амінокислотну послідовність антитіла, що включає константну(і) ділянку(и), або послідовність нуклеїнової кислоти, що кодує константну(і) ділянку(и). В іншому варіанті винаходу, термін “акцептор” означає амінокислотну послідовність антитіла, що включає одну або більше каркасних ділянок і константних ділянок, або послідовність нуклеїнової кислоти, що кодує зазначені ділянки. У конкретному варіанті винаходу, термін “акцептор” означає послідовність людського антитіла, що включає амінокислотну послідовність, або послідовність нуклеїнової кислоти, що кодує амінокислотну послідовність, яка принаймні на 80 %, принаймні на 85 %, принаймні на 90 %, принаймні на 95 %, принаймні на 98 % або 100 % ідентична до амінокислотної послідовності однієї або більше каркасних ділянок. Відповідно до цього варіанта, акцептор може містити принаймні 1, принаймні 2, принаймні 3, принаймні 4, принаймні 5, або принаймні 10 амінокислотних залишків, що не присутні в одному або більше конкретних положеннях людського антитіла. Акцепторна каркасна ділянка і/або акцепторна(і) константна(і) ділянка(и) можуть, наприклад, походити або можуть бути одержані від гена антитіла зародкової лінії, гена зрілого антитіла, функціонального антитіла (наприклад, антитіл, добре відомих фахівцям, антитіл, що знаходяться на стадії розробки, або комерційно доступних антитіл). Використовуваний тут термін “CDR” означає гіперваріабельну ділянку у варіабельних послідовностях антитіла. У кожній із варіабельних ділянок важкого ланцюга і легкого ланцюга присутні три CDR, що, для кожної варіабельної ділянки, позначаються CDR1, CDR2 і CDR3. Використовуваний тут термін “набір CDR” означає групу з трьох CDR, що присутні в одній варіабельній ділянці, що має здатність зв’язуватися з антигеном. Точні межі цих CDR були визначені різним чином залежно від різних систем. Система, описана Кебатом (Kabat et al., Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987) і (1991)), має не тільки однозначну систему нумерації залишків, застосовувану до будь-якої варіабельної ділянки антитіла, але також і точні межі залишків, що визначають три СDR. Ці CDR можуть називатися СDR за Кебатом. Чотія і співробітники (Chothia & Lesk, J. Mol. Biol. 196:901917 (1987) і Chothia et al., Nature 342:877-883 (1989)) знайшли, що деякі субположення в СDR за Кебатом здобувають майже ідентичну конформацію пептидного остова, незважаючи на те, що вони мають значні відмінність на рівні амінокислотної послідовності. Такі підділянки були позначені L1, L2 і L3 або H1, H2 і H3, де “L” і “H” означають ділянки легкого і важкого ланцюга, відповідно. Такі ділянки можуть називатися СDR за Чотієм, які мають межі, що перекриваються із СDR за Кебатом. Інші визначення меж CDR можуть, але не строго, відповідати одній з описаних тут систем, але проте, ці межі перекриваються із СDR за Кебатом, хоча ці ділянки можуть бути коротшими або довшими, ніж це було передбачено або одержано з експериментальних даних, які вказують на те, що конкретні залишки або групи залишків або навіть повнорозмірні СDR не чинять значного впливу на зв’язування з антигеном. В описаних тут способах можуть використовуватися СDR, визначені відповідно до кожної з цих систем, хоча в деяких варіантах використовуються СDR, визначені за Кебатом або Чотієм. 23 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 Використовуваний тут термін “канонічний” залишок означає залишок у CDR або в каркасній ділянці, які визначають конкретну канонічну структуру CDR, визначену в публікації Chothia et al (Chothia and Lesk 1987, J. Mol. Biol. 196 901-17; Chothia et al. 1992 J. Mol. Biol. 227 799-817), що вводиться в даний опис за допомогою посилання, як описано в публікації Chothia та ін., основні положення CDR багатьох антитіл мають майже однакові конфігурації пептидних остовів, незважаючи на значну їхню різноманітність на рівні амінокислотних послідовностей. Кожна канонічна структура характеризується, головним чином, набором торсійних кутів пептидного остова для сегмента з амінокислотних залишків, що йдуть один за одним і утворюють петлю. Використовувані тут терміни “донор” і “донорне антитіло” означають антитіло, що забезпечує присутність однієї або більше СDR. У переважному варіанті винаходу, донорним антитілом є антитіло певного виду, що відрізняється від антитіла, від якого були одержані або від якого походять каркасні ділянки. При описі гуманізованого антитіла, термін “донорне антитіло” означає не-людське антитіло, що забезпечує одну або більш CDR. Використовувані тут терміни “каркасна ділянка” або “каркасна послідовність” означають інші послідовності варіабельної ділянки мінус СDR. Оскільки точне визначення послідовності СDR може бути дане виходячи з інших систем, то термін “каркасна послідовність” може мати, відповідно, іншу інтерпретацію. Шість CDR (CDR-L1, -L2 і -L3 легкого ланцюга і CDR-H1, -H2 і -H3 важкого ланцюга) також розділяють каркасні ділянки в легкому ланцюзі та у важкому ланцюзі на чотири підділянки (FR1, FR2, FR3 і FR4) на кожнім ланцюзі, де СDR1 розташована між FR1 і FR2, CDR2 розташована між FR2 і FR3, і CDR3 розташована між FR3 і FR4. Не вдаваючись до точного визначення таких підділянок як FR1, FR2, FR3 або FR4, каркасну ділянку можна визначити інакше, а саме, вона являє собою об’єднані FR у варіабельній ділянці в одному природному ланцюзі імуноглобуліну. Використовуваний тут термін “ділянка FR” означає одну з чотирьох підділянок, а термін “ділянки FR” означає дві або більше з чотирьох підділянок, що складають каркасну ділянку. Використовувані тут терміни “ген антитіла зародкової лінії” або “генний фрагмент” означають послідовність імуноглобуліну, що кодована нелімфоїдними клітинами, які не піддавалися процесу дозрівання, який призводить до генетичного реаранжування і мутації, і які експресували конкретний імуноглобулін. (Див., наприклад, Shapiro et al., Crit. Rev. Immunol. 22: 183-200; Marchalonis et al., Adv. Exp. Med. Biol. 484:13-30). Одна з переваг різних варіантів відповідно до винаходу була виявлена виходячи з того факту, що гени антитіла зародкової лінії з більшою імовірністю, ніж гени зрілого антитіла, будуть зберігати основні структури амінокислотної послідовності, характерні для індивідуумів даного виду, а отже, менш імовірно, що вони будуть розпізнаватися як послідовності, що походять із чужорідного джерела при їхньому терапевтичному застосуванні в даних видах. Використовуваний тут термін “ключові” залишки означає деякі залишки у варіабельній ділянці, що впливають на специфічність і/або афінність зв’язування антитіла, а зокрема, гуманізованого антитіла. Ключовими залишками є, але не обмежуються ними, один або більше нижченаведених залишків: залишок, що є суміжним з CDR, залишок потенційного сайта глікозилювання (таким сайтом може бути сайт N- або О-глікозилювання), рідкісний залишок, залишок, здатний взаємодіяти з антигеном, залишок, здатний взаємодіяти з CDR, канонічний залишок, контактуючий залишок, що знаходиться між варіабельною ділянкою важкого ланцюга і варіабельною ділянкою легкого ланцюга, залишок у зоні Верньєра і залишок у ділянці, що перекривається з ділянкою, розташованою між CDR1 домену VH, визначеною за Чотієм, і першою каркасною ділянкою важкого ланцюга, визначеною за Кебатом. Використовуваний тут термін “гуманізоване антитіло” означає антитіло або його варіант, похідне, аналог або фрагмент, які імуноспецифічно зв’язуються з антигеном, що становить інтерес, і містять каркасну ділянку (FR), що має, в основному, амінокислотну послідовність людського антитіла і гіперваріабельну ділянку (СDR), що має, в основному, амінокислотну послідовність не-людського антитіла. Використовуваний тут термін “в основному”, що стосується CDR, означає, що CDR має амінокислотну послідовність, що принаймні на 80 %, принаймні на 85 %, принаймні на 90 %, принаймні на 95 %, принаймні на 98 % або принаймні на 99 % ідентична до амінокислотної послідовності СDR не-людського антитіла. Гуманізоване антитіло включає, в основному, усі або принаймні один, а звичайно два варіабельних домени (Fab, Fab, F(ab)2, Fab, Fv), в яких усі або, в основному, всі ділянки CDR відповідають нелюдському імуноглобуліну (тобто, донорному антитілу), а всі або, в основному, усі каркасні ділянки являють собою ділянки, що мають консенсусну послідовність людського імуноглобуліну. Переважно, гуманізоване антитіло також містить принаймні частину константної ділянки імуноглобуліну (Fc), а звичайно людського імуноглобуліну. У деяких варіантах винаходу, гуманізоване антитіло містить легкий ланцюг, а також принаймні варіабельний домен важкого ланцюга. Таке антитіло також може включати ділянки СН1, шарнірну ділянку, і ділянки CH2, CH3, 24 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 і CH4 важкого ланцюга. У деяких варіантах винаходу, гуманізоване антитіло також містить гуманізований легкий ланцюг. У деяких варіантах винаходу, гуманізоване антитіло також містить гуманізований важкий ланцюг. У конкретних варіантах винаходу, гуманізоване антитіло містить тільки гуманізований варіабельний домен легкого ланцюга і/або гуманізований важкий ланцюг. Гуманізоване антитіло може бути вибране з будь-якого класу імуноглобулінів, включаючи IgM, IgG, IgD, IgA і IgE, і будь-якого ізотипу, включаючи, але не обмежуючи ними, IgG1, IgG2, IgG3 і IgG4. Гуманізоване антитіло може включати послідовності більш, ніж одного класу або ізотипу, а домени константної ділянки можуть бути вибрані для оптимізації потрібних ефекторних функцій із застосуванням добре відомих методів. Каркасні ділянки і ділянки CDR гуманізованого антитіла необов’язково повинні точно відповідати батьківським послідовностям, наприклад, CDR або консенсусна каркасна ділянка донорного антитіла можуть бути піддані мутагенезу шляхом заміни, інсерції і/або делеції принаймні одного амінокислотного залишку так, щоб залишок СDR або каркасної ділянки в цьому сайте не відповідали залишкам донорного антитіла або консенсусної каркасної ділянки. Однак, у переважному варіанті винаходу, таких мутацій не повинно бути занадто багато. Звичайно, залишки гуманізованого антитіла принаймні на 80 %, переважно, принаймні на 85 %, більш переважно, принаймні на 90 %, а найбільше переважно, принаймні на 95 % відповідають залишкам батьківських послідовностей FR і CDR. Використовуваний тут термін “консенсусна каркасна ділянка” означає каркасну ділянка в консенсусній послідовності імуноглобуліну. Використовуваний тут термін “консенсусна послідовність імуноглобуліну” означає послідовність, утворену амінокислотами (або нуклеотидами), що найбільше часто зустрічаються в сімействі споріднених послідовностей імуноглобуліну (див. наприклад, Winnaker, From Genes to Clones, Verlagsgesellschaft, Weinheim, Germany 1987). У сімействі імуноглобулінів, кожне положення в консенсусній послідовності зайнято амінокислотою, що найбільш часто зустрічається в цьому положенні даного сімейства. Якщо дві амінокислоти зустрічаються з однаковою частотою, то в консенсусну послідовність може бути включена кожна з цих амінокислот. Використовуваний тут термін “зона Верньєра” означає підпослідовність каркасних залишків, що може коректувати структуру CDR і точно регулювати збирання антигену, як описано в публікації Foote et al. 1992 J. Mol. Biol. 224, 487-99. Залишки зони Верньєра утворюють шар, що лежить в основі CDR і можуть впливати на структуру CDR і афінність антитіла. Використовуваний тут термін “нейтралізація” стосується запобігання біологічній активності цитокіну при його специфічному зв’язуванні з цитокіном. Переважним нейтралізуючим антитілом є нейтралізуюче антитіло, зв’язування якого з IL-12 і/або IL-23 призводить до інгібування біологічної активності IL-12 і/або IL-23. Переважно, антитіло, що нейтралізує, зв’язується з IL-12 і/або IL-23 і знижує біологічну активність IL-12 і/або IL-23 принаймні приблизно на 50 %, 60 %, 80 %, 85 % або більше. Використовуваний тут термін “інгібування” означає зниження біологічної активності цитокіну при специфічному зв’язуванні антитіла з цитокіном. Інгібування біологічної активності IL-12 і/або IL-23 нейтралізуючим антитілом може бути оцінене шляхом визначення одного або більше показників біологічної активності IL-12 і/або IL-23, добре відомих фахівцям. Так, наприклад, може бути оцінено інгібування проліферації бластів у присутності людського фітогемаглютиніну в in vitro аналізі на IL-12 PHA або інгібування зв’язування з рецептором в аналізі на зв’язування з людським рецептором IL-12 (див. приклади). Термін “активність” включає активності, такі як специфічність/афінність зв’язування антитіла з антигеном, наприклад, анти-IL-12 антитіла, що зв’язується з антигеном IL-12; і/або нейтралізуюча активність антитіла, наприклад, анти-IL-12 антитіла, що, при його зв’язуванні з IL12, інгібує біологічну активність hIL-12, наприклад, інгібує проліферацію PHA-бластів або інгібує зв’язування з рецептором в аналізі на зв’язування з людським рецептором IL-12 або в РНАаналізі на IL-12 in vitro. Термін “епітоп” включає будь-яку поліпептидну детермінанту, здатну специфічно зв’язуватися з імуноглобуліном або Т-клітинним рецептором. У деяких варіантах винаходу, детермінанти або епітопи включають хімічно активні поверхневі групи молекул, таких як амінокислоти, цукрові бічні ланцюги, фосфорил або сульфоніл, а в деяких варіантах винаходу, вони можуть мати специфічні тривимірні структурні властивості і/або можуть мати конкретний заряд. Епітоп являє собою ділянку антигену, що зв’язується з антитілом. У деяких варіантах винаходу вважається, що антитіло специфічно зв’язується з антигеном, якщо воно переважно розпізнає антиген-мішень у комплексній суміші білків і/або макромолекул. Даний винахід також стосується антитіла, що інгібує активність IL-12/23 в антигенпрезентуючих клітинах (АПК), таких як, але не обмежуваних ними, макрофаги, мікрогліальні клітини, мезангіальні фагоцити, синовіальні клітини А, попередники стовбурових клітин, клітини Лангерганса, клітини Купфера, дендритні клітини, В-клітини і т. ін. Такі АПК 25 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 можуть бути присутніми у різних тканинах, наприклад, таких як, але не обмежуваних ними, тканини шкіри, епідермісу, печінки, селезінки, головного мозку, спинного мозку, тимуса, кісткового мозку, суглобної синовіальної рідини, нирок, крові і т. ін. Такі АПК можуть також бути присутнім тільки з зовнішнього боку або з внутрішнього боку гематоенцефалічного бар’єра. Даний винахід стосується виділених, рекомбінантних і/або синтетичних антитіл, їхніх специфічних частин або варіантів, а також композицій і кодуючих молекул нуклеїнової кислоти, що містить принаймні один полінуклеотид, що кодує принаймні одне антитіло. Такі антитіла, їхні специфічні частини або варіанти відповідно до винаходу включають специфічні повнорозмірні послідовності антитіл, їхні домени, фрагменти, і специфічні варіанти, і даний винахід також стосується способів одержання і застосування зазначених нуклеїнових кислот і антитіл, а також їхніх специфічних частин або варіантів, включаючи терапевтичні композиції, способи і пристрої. Антитіла, що можуть бути використані в даному винаході, характеризуються, але необов’язково, своєю терапевтичною дією на пацієнтів протягом тривалих періодів часу, яка полягає в хорошому або чудовому ослабленні симптомів і низькій токсичності. Терапевтичні ефекти можуть бути досягнуті за рахунок низкою імуногенності і/або високої афінності, а також за рахунок інших придатних властивостей. Термін “низька імуногенність” визначений тут як збільшення значимих HAHA-, HACA- або HAMA-відповідей у менше, ніж приблизно 75 %, або переважно, у менше, ніж приблизно 50 % пацієнтів, що піддаються лікуванню, і/або підвищення низьких титрів у пацієнта, що піддається лікуванню (менше, ніж приблизно на 300, а переважно, менше, ніж приблизно на 100, як було виміряно за допомогою імуноферментного аналізу з двома антигенами; Elliott et al. 1994 Lancet, 344:1125-7). Виділені нуклеїнові кислоти відповідно до винаходу можуть бути використані для продукування принаймні одного антитіла, його або фрагмента специфічного варіанта, що можуть бути використані в клітинах, тканинах, органах або в організмі тварини (включаючи ссавців і людину) для модуляції, усунення, полегшення, попередження принаймні одного стану, асоційованого з IL-12 і/або IL-23, або ослаблення його симптомів. Такий спосіб може включати введення ефективної кількості або композиції фармацевтичної композиції, що містить принаймні одне антитіло або його специфічну частину або варіант, у клітину, тканину, орган, організм тварини або пацієнта, що потребує модуляції, усунення, полегшення, попередження або ослаблення симптомів і побічних ефектів даного стану або механізмів його виникнення. Ефективна кількість може являти собою кількість приблизно від 0,001 до 500 мг/кг на одне або множина введень або кількість, необхідну для досягнення концентрації в сироватці 0,01-5000 мкг/мл сироватки на одне або більш уведень, або будь-яку ефективну кількість, що входить в інтервал значень ефективних кількостей, що був обчислений і визначений відомими методами, описаними в даній заявці або в спеціальній літературі. Антитіла, що є специфічними до субодиниці IL-12p40, можуть вироблятися проти відповідного імуногенного антигену, такого як виділений білок IL-12p40, IL-12 або IL-23 або його частина (включаючи синтетичні молекули, такі як синтетичні пептиди). Одержання імуногенних антигенів і продукування моноклональних антитіл може бути здійснено будь-яким придатним методом. У літературі був описаний ряд методів (див., наприклад, публікації Kohler et al. 1975 Nature, 256:495-7 і Kohler et al. 1976 Eur. J. Immunol. 6:511-9; Galfre et al. 1977 Nature 266 550-2; Koprowski et al., патент США № 4172124; Harlow, E. and D. Lane, 1988, Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory: Cold Spring Harbor, N.Y.; Current Protocols In Molecular Biology, Vol. 2 (e.g., Supplement 27, Summer '94), Ausubel, F. M. et al, Eds., John Wiley & Sons: New York, N.Y., Chapter 11, (1991-2003)), що у всій своїй повноті вводяться в даний опис за допомогою посилання. Звичайно гібридому одержують шляхом злиття придатної імморталізованої клітинної лінії (наприклад, мієломної клітинної лінії, такої як, але не обмежуваної ними, Sp2/0, Sp2/0-AG14, NSO, NS1, NS2, AE-I, L.5, >243, P3X63Ag8.653, Sp2 SA3, Sp2 MAI, Sp2 SS1, Sp2 SA5, U937, MLA 144, ACT IV, MOLT4, DA-I, JURKAT, WEHI, K-562, COS, RAJI, NIH 3T3, HL-60, MLA 144, NAMAIWA, NEURO 2A або т. ін., або гетеромієлом, їхніх продуктів злиття, або будь-яких клітин, або злитих клітин, що походять від них, або будь-якої іншої придатної клітинної лінії, відомої фахівцям, див., наприклад, сайти www.atcc.org, www.lifetech.com., і т. ін., кожен з яких у всій своїй повноті вводиться в даний опис за допомогою посилання) з антитіло-продукуючими клітинами, такими як, але не обмежуваними ними, виділені або клоновані клітини селезінки або будь-які інші клітини, експресуючі послідовності константної ділянки, варіабельної ділянки, каркасної ділянки або CDR важкого або легкого ланцюга у вигляді або ендогенної, або гетерологічної нуклеїнової кислоти, рекомбінантної або ендогенної, а саме, нуклеїнової кислоти вірусів, бактерій, водоростей, прокаріотів, амфібій, комах, рептилій, риб, ссавців, гризунів, коней, овець, кіз, баранів, приматів, еукаріотів; геномної ДНК, кДНК, рДНК, мітохондріальної ДНК або РНК, ДНК або РНК хлоропластів, людської РНК, мРНК, тРНК, 26 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 одноланцюгової, дволанцюгової або триланцюгової РНК, гібридизованої РНК, і т. ін. або будьяких їхніх комбінацій. Див, наприклад, посібники Ausubel, вище, і Colligan, Immunology, вище, розділ 2, кожен з яких у всій своїй повноті вводиться в даний опис за допомогою посилання. Антитіло-продукуючі клітини можуть бути одержані з периферичної крові або, переважно, селезінки або лімфовузлів людини або інших придатних тварин, імунізованих антигеном, що становить інтерес. Для експресії гетерологічної або ендогенної нуклеїнової кислоти, що кодує антитіло, його специфічний фрагмент або варіант відповідно до винаходу, можуть бути також використані будь-які інші придатні клітини-хазяїни. Злиті клітини (гібридоми) або рекомбінантні клітини можуть бути виділені в селективних умовах культивування або будь-якими іншими придатними відомими методами, і можуть бути клоновані шляхом лімітованого розведення, або клітинного сортингу, або іншими відомими методами. Клітини, що продукують антитіла з потрібною специфічністю, можуть бути відібрані за допомогою придатного аналізу (наприклад, ELISA). Можуть бути застосовані й інші придатні методи продукування або виділення антитіл із потрібною специфічністю, включаючи, але не обмежуючи ними, методи відбору рекомбінантного антитіла з пептидної або білкової бібліотеки (наприклад, такої як, але не обмежуваної ними, бактеріофагова, рибосомна та олігонуклеотидна бібліотека, бібліотека РНК, бібліотека кДНК або т. ін., бібліотека представлення, наприклад, що постачаються Cambridge Antibody Technologies, Cambridgeshire, UK; MorphoSys, Martinsreid/Planegg, DE; Biovation, Aberdeen, Scotland, UK; Biolnvent, Lund, Sweden; Dyax Corp., Enzon, Affymax/Biosite; Xoma, Berkeley, Calif.; Ixsys, див., наприклад, EP 368684, PCT/GB91/01134; PCT/GB92/01755; PCT/GB92/002240; PCT/GB92/00883; PCT/GB93/00605; заявку на патент США реєстр. № 08/350260 (12 травня 1994 р.); PCT/GB 94/01422; PCT/GB94/02662; PCT/GB 97/01835; (CAT/MRC); WO90/14443; WO90/14424; WO90/14430; PCT/US594/1234; WO92/18619; WO96/07754; (Scripps); WO96/13583, WO97/08320 (MorphoSys); WO95/16027 (Biolnvent); WO88/06630; WO90/3809 (Dyax); патент США № 4704692 (Enzon); PCT/US91/02989 (Affymax); WO89/06283; EP 371998; EP 550400; (Xoma); EP 229046; PCT/US91/07149 (Ixsys); або стохастично продуковані пептиди або білки, патенти США №№ 5723323, 5763192, 5814476, 5817483, 5824514, 5976862, WO 86/05803, EP 590689 (Ixsys, дана назва “Applied Molecular Evolution” (AME), які у всій своїй повноті вводяться в даний опис за допомогою посилання), або методи, основані на імунізації трансгенних тварин (наприклад, мишей SCID, див., публікації Nguyen et al. 1997 Microbiol. Immunol. 41 901-7; Sandhu et al. 1996 Crit. Rev. Biotechnol. 16, 95118; кожна з яких у всій своїй повноті вводиться в даний опис за допомогою посилання, а також споріднені патенти і заявки), які мають здатність продукувати визначений репертуар людських антитіл, відомих фахівцям і/або описаних у даній заявці. Такими методами є, але не обмежуються ними, метод рибосомного представлення (Hanes et al. 1997 Proc. Natl. Acad. Sci. USA 94, 4937-42; Hanes et al. 1998 Proc. Natl. Acad. Sci. USA 95 14130-5); технології продукування антитіл однією клітиною (наприклад, метод відбору лімфоцитотоксичних антитіл (“SLAM”) патент США № 5627052, Wen et al. 1987 Eur. J. Immunol. 17, 887-92; Babcook et al. 1996 Proc. Natl. Acad. Sci. USA 93, 7843-8); метод гелевих мікрокрапельок і проточної цитометрії (Powell et al. 1990 Biotechnology (NY) 8 333-7); методи із застосуванням одноклітинних систем, Cambridge, Mass.; (Gray et al. 1995 J. Immunol. Methods 182 155-63; Kenney et al. 1995 Biotechnology (NY) 13 787-90); метод відбору В-клітин (Steenbakkers et al. 1994 Mol Biol. Rep. 19, 125-34; Jonak et al., Progress Biotech, Vol. 5, In vitro Immunization in Hybridoma Technology, Borrebaeck, ed., Elsevier Science Publishers B. V., Amsterdam, Netherlands (1988), кожен з яких у всій своїй повноті вводиться в даний опис за допомогою посилання). Для введення антитіл людині in vivo можуть виявитися переважними химерні, гуманізовані або людські антитіла. Химерним антитілом є молекула, в якій різні частини антитіла походять від тваринних різних видів, і такими антитілами є антитіла, що мають варіабельну ділянка, що походить від мишачого моноклонального антитіла, і константну ділянка людського імуноглобуліну. Методи продукування химерних антитіл відомі фахівцям. Див., наприклад, Morrison (1985); Oi (1986); Gillies (1989); патенти США № 5807715; 4816567; і 4816397. До обсягу даного винаходу входять деімунізовані антитіла, що можуть бути використані для здійснення способів відповідно до винаходу, і які мають різні послідовності, одержані методами, описаними, наприклад, у патентній публікації EP 0983303A1, у заявках WO 2000/34317 і WO 98/52976. Іншим способом, що входить до обсягу даного винаходу і застосовуваним для мінімізації імуногенних і алергійних відповідей, властивих мишачим або іншим нелюдським моноклональним антитілам, і для підвищення ефективності і безпеки антитіл, що вводяться, є “маскування”. Термін “масковане антитіло” означає антитіло, в якому була зроблена селективна 27 UA 104297 C2 5 10 15 20 25 30 35 40 45 50 55 60 заміна залишків каркасної ділянки, що походять, наприклад, від варіабельної ділянки мишачого важкого або легкого ланцюга, залишками людської каркасної ділянки, з метою одержання ксеногенної молекули, що містить антигензв’язувальний сайт, який зберігає, в основному, все укладання структури нативної каркасної ділянки. В основі методів маскування лежить той факт, що ліганд-зв’язувальні властивості антигензв’язувального сайта визначаються, головним чином, структурою і відносним розташуванням наборів CDR важкого і легкого ланцюгів на антигензв’язувальній поверхні (Davies (1990)). Таким чином, специфічність зв’язування з антигеном може бути збережена в гуманізованому антитілі тільки при повному збереженні структур CDR, їхньої взаємодії одна з одною і їхньої взаємодії з іншими доменами в V-ділянці. Із застосуванням методів маскування, зовнішні (наприклад, доступні для розчинника) залишки каркасної ділянки, що легко взаємодіють з імунною системою, селективно заміняють людськими залишками, у результаті чого одержують гібридну молекулу, що має слабоімуногенну або, в основному, неімуногенну масковану поверхню. До обсягу даного винаходу також входять гуманізовані анти-IL-12/IL-23 антитіла. “Гуманізованими” формами анти-IL-12/IL-23 антитіл є антитіла, що містять мінімальну послідовність, що походить від послідовностей не-людського імуноглобуліну. Здебільшого, гуманізованими антитілами є людські імуноглобуліни (антитіло-реципієнт), в яких залишки гіперваріабельної ділянки (також відомої як гіперваріабельна ділянка або CDR) реципієнта замінені залишками гіперваріабельної ділянки антитіла ссавця, що не є людиною (донорного антитіла), такого як миші, щури, кролики або примати, що не є людиною, де зазначене антитіло має потрібну специфічність, афінність і ємність. Гуманізовані антитіла, що входять до обсягу даного винаходу і використовувані в способах відповідно до винаходу, можуть мати, наприклад, зв’язувальні властивості, аналогічні до властивостей негуманізованих антитіл, таких як, наприклад, моноклональне антитіло PMA204, описане в даній заявці. Гуманізація може бути, в основному, здійснена методом, описаним Winter і співробітниками (Jones (1986); Riechmann (1988); Verhoeyen (1988)), шляхом заміни послідовностей CDR гризунів або мутантних гризунів відповідними послідовностями CDR людського антитіла. Див., також патенти США № 5225539; 5585089; 5693761; 5693762; і 5859205. Антитіла можуть бути гуманізовані рядом методів, відомих фахівцям, включаючи, наприклад, метод CDR-прищеплення (EP 239400; публікація заявки PCT WO 91/09967; патенти США № 5225539; 5530101; і 5585089), методи маскування або обробки (EP 592106; EP 519596; Padlan (1991); Studnicka (1994); Roguska (1994)), і перестановки ланцюгів (патент США № 5565332). У деяких випадках, залишки каркасних ділянок однієї або більше варіабельних ділянок людського імуноглобуліну заміняють відповідними не-людськими залишками (див., наприклад, Queen et al., патент США № 5585089; патенти США №№ 5693761; 5693762; і 6180370; див., також, наприклад, Riechmann (1988)). “Надгуманізація” являє собою спосіб гуманізації, в якому CDR, що надають специфічність до антигену (“донор”), приєднують до каркасних послідовностей людської зародкової лінії (“акцептор”), які, як відомо, експресуються разом з людськими CDR, що мають структуру, ідентичну або аналогічну до структури донорних CDR (Tan 2002, див. також публікацію Міжнародної заявки № WO 2004/006955). При використанні каркасних ділянок, кодованих послідовностями генів V генома людини, а не послідовностей, які можуть включати соматичні мутації, цей спосіб дозволяє ще більше знижувати імуногенність. При встановленні структурної гомології між донорними та акцепторними CDR, цей спосіб також підвищує імовірність збереження афінності. Крім того, гуманізовані антитіла можуть містити залишки, що не були виявлені в реципієнті або в антитілі-донорі. Такі модифікації здійснюють для додаткового уточнення властивостей антитіл (наприклад, для одержання бажаної афінності). Загалом, гуманізоване антитіло може містити, власне кажучи, усі або принаймні один, а звичайно два варіабельних домени, в яких усі або, в основному, усі гіперваріабельні ділянки відповідають зазначеним ділянкам не-людського імуноглобуліну і всі або в основному, усі каркасні ділянки являють собою ділянки, що мають зазначену послідовність людського імуноглобуліну. Гуманізоване антитіло може також включати, але не обов’язково, принаймні частину константної ділянки (Fc) імуноглобуліну, звичайно людського імуноглобуліну. Більш детально див. Jones (1986); Riechmann (1988); і Presta (1992). Відповідно до цього, такі “гуманізовані” антитіла можуть включати антитіла, в яких, в основному, менше, ніж один інтактний людський варіабельний домен замінений відповідною послідовністю, що походить від інших видів, що не є людиною. На практиці, гуманізованими антитілами звичайно є людські антитіла, в яких деякі 28

Дивитися

Додаткова інформація

Автори російською

Clarke, Adam, William, Doyle, Anthony, Gerard, Jennings, Philip, Anthony, Poulton, Lynn, Dorothy, Wai, Hoi Yi, Pow, Andrew, James, Kopsidas, George

МПК / Мітки

МПК: A61P 17/06, A61P 25/28, A61P 29/00, A61P 31/00, A61P 41/00, A61P 5/14, A61P 37/08, A61P 1/02, A61P 7/00, A61P 3/08, A61P 27/02, A61P 17/14, A61P 19/10, A61P 35/00, C07K 14/00, A61P 9/10, A61P 13/12, A61P 11/00, A61P 1/16, C07H 21/00, A61P 19/04, A61K 39/395, A61P 19/02, C07K 16/24

Мітки: антитіло

Код посилання

<a href="http://uapatents.com/312-104297-antitilo-proti-il-12-il-23.html" target="_blank" rel="follow" title="База патентів України">Антитіло проти il-12/il-23</a>

Подібні патенти